Citrus Sinensis ID: 010410

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-

MQSLHSFSSLSVLAPPVRLQKPTKTPNFVTIKSCINRNPKEESGSKARSWVSPDWLTSLTKSLTITQSDESNIPVASAKLDDVTDLLGGALFLPLFKWMNVYGPIYRLAAGPRNFVVVSDPAIAKHVLRNYGTKYAKGLVSEVSEFLFGSGFAIAEGPLWMGRRRAVAPSLHKKYLSVIVDCVFCKCAERLVERLQTDALNGTAVNMEEKFSQLTLDVIGLSVFNYNFDSLTADSPVIDAVYTALKEAELRSTDVLPYWKVKALCKIVPRQIKAEKAVTVIRKTVEELIIKCKEIVETEGERIDDEEYVNDSDPSILRFLLASREEDCNSLMKAQEEIDRVLQGRSPSFEDIKDLKFLTRCINESMRLYPHPPVLIRRAQVDDVLPGNYKVNAGQDIMISVYNIHHSSQVWERAEEFLPERFDLEGPMPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMNFELVPDQNINMTTGATIHTTNGLYMKLRQRQHLNSFVSTSR

ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHcccccHHHHHHHHHHcccEEEEccccccEEEEccHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccCEEHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHcccccHHHHHHHHHHccccccccccccccccccEEcccEECccccEEEEccccccccccccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHccCEECcccccccccccCEECccccEEEEEEEcccccccccccc

***************************FVTIKSC***************WVSPDWLTSLTKSLTIT******IPVASAKLDDVTDLLGGALFLPLFKWMNVYGPIYRLAAGPRNFVVVSDPAIAKHVLRNYGTKYAKGLVSEVSEFLFGSGFAIAEGPLWMGRRRAVAPSLHKKYLSVIVDCVFCKCAERLVERLQTDALNGTAVNMEEKFSQLTLDVIGLSVFNYNFDSLTADSPVIDAVYTALKEAELRSTDVLPYWKVKALCKIVPRQIKAEKAVTVIRKTVEELIIKCKEIVETEGERIDDEEYVNDSDPSILRFLLASREEDCNSLMKAQEEIDRVLQGRSPSFEDIKDLKFLTRCINESMRLYPHPPVLIRRAQVDDVLPGNYKVNAGQDIMISVYNIHHSSQVWERAEEFLPERFDLEGP**NESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMNFELVPDQNINMTTGATIHTTNGLYMKLR*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Carotene epsilon-monooxygenase, chloroplastic	Heme-containing cytochrome P450 involved in the biosynthesis of xanthophylls. Specific for epsilon- and beta-ring hydroxylation of alpha-carotene. Has only a low activity toward the beta-rings of beta-carotene. The preferred substrate in planta is not alpha-carotene but the epsilon-ring of zeinoxanthin.	confident	Q6TBX7

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R9O, chain A
Confidence level:very confident
Coverage over the Query: 66-502
View the alignment between query and template
View the model in PyMOL

Template: 3K9V, chain A
Confidence level:very confident
Coverage over the Query: 55-500
View the alignment between query and template
View the model in PyMOL