BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 010453
(510 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3U0G|A Chain A, Crystal Structure Of Branched-Chain Amino Acid
Aminotransferase From Burkholderia Pseudomallei
pdb|3U0G|B Chain B, Crystal Structure Of Branched-Chain Amino Acid
Aminotransferase From Burkholderia Pseudomallei
pdb|3U0G|C Chain C, Crystal Structure Of Branched-Chain Amino Acid
Aminotransferase From Burkholderia Pseudomallei
pdb|3U0G|D Chain D, Crystal Structure Of Branched-Chain Amino Acid
Aminotransferase From Burkholderia Pseudomallei
pdb|3U0G|E Chain E, Crystal Structure Of Branched-Chain Amino Acid
Aminotransferase From Burkholderia Pseudomallei
pdb|3U0G|F Chain F, Crystal Structure Of Branched-Chain Amino Acid
Aminotransferase From Burkholderia Pseudomallei
Length = 328
Score = 31.2 bits (69), Expect = 1.4, Method: Compositional matrix adjust.
Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 4/67 (5%)
Query: 147 SLKVKVNTVLGSHAPPLTVTLVRAFSSSARDNSIIENQELKFDPQDAVYFLD-DLPASFD 205
++VK ++ H + V++VRA +S NSI+ NQE D D LD D S
Sbjct: 161 GIRVKTSSFTRHH---VNVSMVRAKASGWYVNSILANQEATADGYDEALLLDVDGYVSEG 217
Query: 206 VGEYIFV 212
GE F+
Sbjct: 218 SGENFFL 224
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.137 0.381
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,763,777
Number of Sequences: 62578
Number of extensions: 437110
Number of successful extensions: 973
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 973
Number of HSP's gapped (non-prelim): 3
length of query: 510
length of database: 14,973,337
effective HSP length: 103
effective length of query: 407
effective length of database: 8,527,803
effective search space: 3470815821
effective search space used: 3470815821
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)