Citrus Sinensis ID: 010469


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MSTRYILLLSLTILLLFSPALAKSQNDAASDDDEDLSFLEEADADTKSKAASHHQFGEKDGDPDDDDFSDDFDDENYHDFDDSEYKEPEIDDKDVVVLKERNFSDVIENNKFVMVEFYAPWCGHCQALAPEYAAAATELKSANESVVLAKVDATEENELAHEYDVQGFPTIYFFVDGQHKAYNGGRTKDAIVTWIKKKIGPGIYNITTLDEAERVLTSETKVVLGYLNSLVGSESEVLADASRLEDDVNFYQTTNPDVAKIFHLDSKVNRPALVMVKKETEKISYFADGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLEGKLKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKVIFDVNL
cHHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccEEEccccHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHcccccccEEEEECccccccccccccHHHHHHHHHHHccccEEEcccHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHccccCEEEEECccHHHHHHccccccccccEEEEccccccEECccccccccHHHHHHHHHcccccEEEEEcccccccccccccEEEEEEECcccHHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHcccccccccEEEEccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccEEEEEccccEEEEccccccEEEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccEEEc
*STRYILLLSLTILLLFSPALAKSQNDAASDDDEDLSFLEEADADTKSKAAS*********DPDDDDFSDDFD*******************KDVVVLKERNFSDVIENNKFVMVEFYAPWCGHCQALAPEYAAAATELKSANESVVLAKVDATEENELAHEYDVQGFPTIYFFVDGQHKAYNGGRTKDAIVTWIKKKIGPGIYNITTLDEAERVLTSETKVVLGYLNSLVGSESEVLADASRLEDDVNFYQTTNPDVAKIFHLDSKVNRPALVMVKKETEKISYFADGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLEGKLKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKVIFDVNL
xxxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTRYILLLSLTILLLFSPALAKSQNDAASDDDEDLSFLEEADADTKSKAASHHQFGEKDGDPDDDDFSDDFDDENYHDFDDSEYKEPEIDDKDVVVLKERNFSDVIENNKFVMVEFYAPWCGHCQALAPEYAAAATELKSANESVVLAKVDATEENELAHEYDVQGFPTIYFFVDGQHKAYNGGRTKDAIVTWIKKKIGPGIYNITTLDEAERVLTSETKVVLGYLNSLVGSESEVLADASRLEDDVNFYQTTNPDVAKIFHLDSKVNRPALVMVKKETEKISYFADGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLEGKLKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKVIFDVNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein disulfide isomerase-like 1-4 Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.probableQ9FF55
Protein disulfide isomerase-like 1-4 Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds. May play a role in storage protein biogenesis.probableQ67IX6
Protein disulfide-isomerase This multifunctional protein catalyzes the formation, breakage and rearrangement of disulfide bonds. At the cell surface, seems to act as a reductase that cleaves disulfide bonds of proteins attached to the cell. May therefore cause structural modifications of exofacial proteins. Inside the cell, seems to form/rearrange disulfide bonds of nascent proteins. At high concentrations, functions as a chaperone that inhibits aggregation of misfolded proteins. At low concentrations, facilitates aggregation (anti-chaperone activity). May be involved with other chaperones in the structural modification of the TG precursor in hormone biogenesis. Also acts a structural subunit of various enzymes such as prolyl 4-hydroxylase and microsomal triacylglycerol transfer protein MTTP.probableQ8R4U2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.3.-.-Intramolecular oxidoreductases.probable
5.3.4.-Transposing S-S bonds.probable
5.3.4.1Protein disulfide-isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B5E, chain A
Confidence level:very confident
Coverage over the Query: 92-501
View the alignment between query and template
View the model in PyMOL
Template: 2TRC, chain P
Confidence level:confident
Coverage over the Query: 62-198
View the alignment between query and template
View the model in PyMOL