BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010497
         (509 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4AV2|M Chain M, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|N Chain N, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|O Chain O, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|P Chain P, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|Q Chain Q, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|R Chain R, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|S Chain S, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|T Chain T, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|U Chain U, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|V Chain V, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|W Chain W, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis.
 pdb|4AV2|X Chain X, Single Particle Electron Microscopy Of Pilq Dodecameric
           Complexes From Neisseria Meningitidis
          Length = 181

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 336 NGFLRKRMGSGSQSEISPDTIKRIKRVKKLTKMSEKVATGILSGVVKVSGFF 387
           N F  +RM +  + E +PDT KRIK   +   +      GIL    KVSGF 
Sbjct: 61  NAFDFRRMETDKKGENAPDT-KRIKETLEKFSLENMRYVGILKSGQKVSGFI 111


>pdb|2TPL|A Chain A, Tyrosine Phenol-lyase From Citrobacter Intermedius Complex
           With 3-(4'- Hydroxyphenyl)propionic Acid,
           Pyridoxal-5'-phosphate And Cs+ Ion
 pdb|2TPL|B Chain B, Tyrosine Phenol-lyase From Citrobacter Intermedius Complex
           With 3-(4'- Hydroxyphenyl)propionic Acid,
           Pyridoxal-5'-phosphate And Cs+ Ion
          Length = 456

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 192 EPAVKLDDSHYFFTLRVPE--NGSLETDQVHHEVLNYGLTIATKGQKHLLKELDKVLE-- 247
           +P   +  + YF T R  +  NG++  D V  E  + GL IA KG    LK+L K+++  
Sbjct: 112 KPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDID-LKKLQKLIDEK 170

Query: 248 -----TYSCFSV 254
                 Y C +V
Sbjct: 171 GAENIAYICLAV 182


>pdb|2YHK|A Chain A, D214a Mutant Of Tyrosine Phenol-Lyase From Citrobacter
           Freundii
 pdb|2YHK|B Chain B, D214a Mutant Of Tyrosine Phenol-Lyase From Citrobacter
           Freundii
          Length = 456

 Score = 28.5 bits (62), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 192 EPAVKLDDSHYFFTLRVPE--NGSLETDQVHHEVLNYGLTIATKGQKHLLKELDKVLE-- 247
           +P   +  + YF T R  +  NG++  D V  E  + GL IA KG    LK+L K+++  
Sbjct: 112 KPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDID-LKKLQKLIDEK 170

Query: 248 -----TYSCFSV 254
                 Y C +V
Sbjct: 171 GAENIAYICLAV 182


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.131    0.380 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,375,260
Number of Sequences: 62578
Number of extensions: 506299
Number of successful extensions: 1156
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 11
Number of HSP's that attempted gapping in prelim test: 1156
Number of HSP's gapped (non-prelim): 11
length of query: 509
length of database: 14,973,337
effective HSP length: 103
effective length of query: 406
effective length of database: 8,527,803
effective search space: 3462288018
effective search space used: 3462288018
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)