Citrus Sinensis ID: 010525


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51
MNRISLTIYLAVFWLLTESSGAETVMFSTKLIHRFSEEVKALGVSKNRNATSWPAKKSFEYYQVLLSSDVQKQKMKTGPQFQMLFPSQGSKTMSLGNDFGCDLLWIPCDCVRCAPLSASYYNSLDRDLNEYSPSASSTSKHLSCSHRLCDLGTSCQNPKQPCPYTMDYYTENTSSSGLLVEDILHLISGGDNALKNSVQASVIIGCGMKQSGGYLDGVAPDGLIGLGLGEISVPSLLAKAGLIRNSFSMCFDKDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTSFKAIVDSGSSFTFLPKEVYETIAAEFDRQVNDTITSFEGYPWKCCYKSSSQRLPKLPSVKLMFPQNNSFVVNNPVFVIYGTQVVTGFCLAIQPVDGDIGTIGQNFMTGYRVVFDRENLKLGWSHSNCQDLNDGTKSPLTPGPGTPSNPLPANQEQSSPGGHAVGPAVAGRAPSKPSTASTQLISSRSSSLKVLPFLLLLRLLVSAS
cccHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccccccccccccccccHHHHHHHccccccccccccccEEEEEEccccccEEEEEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccCEEEEEEEEEEEEEccccccccccccccEEEEccccccccccccccccCEECcccccccHHHHHHHcccccccEEEEccccccccEEEccccccccCEEEccccccccccEEEEEEEEEEccEEEccccccEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccccEEEccccccccccEEEEEEccccEEECccccEEEEEcccccEEEEEECcccccEEEEcccccCEEEEEEEccccEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcc
**RISLTIYLAVFWLLTESSGAETVMFSTKLIHRFSEEVKALGVSKNRNATSWPAKKSFEYYQVLLS*********TGPQFQMLFPSQGSKTMSLGNDFGCDLLWIPCDCVRCAPLSASYYNSLDRDLNEYSPSASSTSKHLSCSHRLCDLGTSCQNPKQPCPYTMDYYTENTSSSGLLVEDILHLISGGDNALKNSVQASVIIGCGMKQSGGYLDGVAPDGLIGLGLGEISVPSLLAKAGLIRNSFSMCFDKDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTSFKAIVDSGSSFTFLPKEVYETIAAEFDRQVNDTITSFEGYPWKCCYKSSSQRLPKLPSVKLMFPQNNSFVVNNPVFVIYGTQVVTGFCLAIQPVDGDIGTIGQNFMTGYRVVFDRENLKLGWSHSNC*********************************************************SRSSSLKVLPFLLLLRLLVSAS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRISLTIYLAVFWLLTESSGAETVMFSTKLIHRFSEEVKALGVSKNRNATSWPAKKSFEYYQVLLSSDVQKQKMKTGPQFQMLFPSQGSKTMSLGNDFGCDLLWIPCDCVRCAPLSASYYNSLDRDLNEYSPSASSTSKHLSCSHRLCDLGTSCQNPKQPCPYTMDYYTENTSSSGLLVEDILHLISGGDNALKNSVQASVIIGCGMKQSGGYLDGVAPDGLIGLGLGEISVPSLLAKAGLIRNSFSMCFDKDDSGRIFFGDQGPATQQSTSFLASNGKYITYIIGVETCCIGSSCLKQTSFKAIVDSGSSFTFLPKEVYETIAAEFDRQVNDTITSFEGYPWKCCYKSSSQRLPKLPSVKLMFPQNNSFVVNNPVFVIYGTQVVTGFCLAIQPVDGDIGTIGQNFMTGYRVVFDRENLKLGWSHSNCQDLNDGTKSPLTPGPGTPSNPLPANQEQSSPGGHAVGPAVAGRAPSKPSTASTQLISSRSSSLKVLPFLLLLRLLVSAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aspartic proteinase-like protein 1 probableQ9LX20

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QDM, chain A
Confidence level:very confident
Coverage over the Query: 79-115,128-143,162-427
View the alignment between query and template
View the model in PyMOL
Template: 3VLA, chain A
Confidence level:very confident
Coverage over the Query: 79-113,134-427
View the alignment between query and template
View the model in PyMOL
Template: 3PVK, chain A
Confidence level:very confident
Coverage over the Query: 79-143,162-440
View the alignment between query and template
View the model in PyMOL