Citrus Sinensis ID: 010563


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------
MKKSPLAMQSTSQTQKNKPLHEKEALVKLLRWHFGHAQFRDKQLDAIQAVLSGRDCFCLMPTGGGKSMCYQIPALAKPGIVLVVSPLIALMENQVIGLKEKGIAGEFLSSTQTMQVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLPSKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISSQDMTDGGQYSEFWNRDDEASGSEEDISDCDGNINLVIISRC
cccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEccccccccHHHHcccccccccEEEEccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEEEcccccccccccccHHHHHHHHHHHHcccccccHHcccccHHHHHHHHHHccccccccccccccccccEEEEEEccccccHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEccccccccccccEEEEEcccccccHHHHHccccccccccccCEEEECccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccCEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHcc
************************ALVKLLRWHFGHAQFRDKQLDAIQAVLSGRDCFCLMPTGGGKSMCYQIPALAKPGIVLVVSPLIALMENQVIGLKEKGIAGEFLSSTQTMQVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLPSKSLLYYGMDDRRRMEF***********************ISDFSQMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISSQDM****************SGSEEDISDCDGNINLVIISRC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKSPLAMQSTSQTQKNKPLHEKEALVKLLRWHFGHAQFRDKQLDAIQAVLSGRDCFCLMPTGGGKSMCYQIPALAKPGIVLVVSPLIALMENQVIGLKEKGIAGEFLSSTQTMQVKTKIYEDLDSGKPSLRLLYVTPELTATPGFMSKLKKIHSRGLLNLVAIDEAHCISSWGHDFRPSYRKLSSLRNYLPDVPILALTATAAPKVQKDVMESLCLQNPLVLKSSFNRPNLFYEVRYKDLLDDAYADLCSVLKANGDTCAIVYCLERTTCDELSAYLSAGGISCAAYHAGLNDKARSSVLDDWISSRKQVVVATVAFGMGIDRKDVRLVCHFNIPKSMEAFYQESGRAGRDQLPSKSLLYYGMDDRRRMEFILSKNQSKNSQSFSTRERSSKKSISDFSQMVDYCEGSGCRRKKILESFGEQIPVSLCKNSCDACKHPNLLAKYLGELTSAVLQKNHFSQIFISSQDMTDGGQYSEFWNRDDEASGSEEDISDCDGNINLVIISRC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent DNA helicase Q-like 3 3'-5' DNA helicase that may play a role in the repair of DNA. Exhibits an ATP or dATP-dependent DNA-helicase activity. Can not use GTP/dGTP, CTP/dCTP or UTP/dUTP as nucleotide cofactors. Catalyzes DNA strand annealing. On nicked Holliday junctions, unwinds the lagging strand. Can not act on intact Holliday junctions.probableQ9FT72

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.12DNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OYW, chain A
Confidence level:very confident
Coverage over the Query: 15-439
View the alignment between query and template
View the model in PyMOL