Citrus Sinensis ID: 010636


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-----
MQMMVPTRRFAVVLVLLLVVLLGVLRDASAKGGEFTGDYPKLSGIIIPGFASTQLRAWSILDCPYSPLDFNPLDLVWLDTTKLLSAVNCWLKCMTLDPYNQTDNPECKSRPDSGLSAITELDPGYITGPLSSVWKEWVKWCIEFGIEANSIIAAPYDWRLSPSKLEERDLYFHKLKLTFETALKLRGGPSLVLAHSLGNNVFRYFLEWLKLEIPPKQYIKWLDEHIHAYFAVGSPFLGATQSVKATLSGETSGLPVSEGTARLMFNSFGSSLWMMPFSKYCRADNKYWKHFSGGTRKDHHIHQCDEQEFRSNYSGWPTNLINIEIPSIRGLEAYPSVSEVAHNNFSSIECGLPTQLSFSAREISDGTFFKAIEDYDPESKRLLHLLEKSYHGDPVLNPLTPWDRPPIKNIFCIYGIDSKTEVGYYFAPSGKPYPDNWIITDVIYEIEGSLFSRSGNLVEGNPGPTSGDETVPYHSLSWCKNWLGPKVNITRAPQNIKKKQTLFPT
cccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcccccccEEEEcccccccccccccccccccccHHHHHHcHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccccccHHHHHHHHcEEEEEcccccccHHHHHHHHccccccccccHHHHHHHHHHcccccccccccccccccccEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEccccccCEEEEEccccccccccccEEccEEEcccccccccccccccccccccccccccHHHHHHHHcccccccccccccEEEEEccccccc
******TRRFAVVLVLLLVVLLGVLRDASAKGGEFTGDYPKLSGIIIPGFASTQLRAWSILDCPYSPLDFNPLDLVWLDTTKLLSAVNCWLKCMTLDPYNQTDNPECKSRPDSGLSAITELDPGYITGPLSSVWKEWVKWCIEFGIEANSIIAAPYDWRLSPSKLEERDLYFHKLKLTFETALKLRGGPSLVLAHSLGNNVFRYFLEWLKLEIPPKQYIKWLDEHIHAYFAVGSPFLGATQSVKATLSGETSGLPVSEGTARLMFNSFGSSLWMMPFSKYCRADNKYWKHFSGGTRKDHHIHQCDEQEFRSNYSGWPTNLINIEIPSIRGLEAYPSVSEVAHNNFSSIECGLPTQLSFSAREISDGTFFKAIEDYDPESKRLLHLLEKSYHGDPVLNPLTPWDRPPIKNIFCIYGIDSKTEVGYYFAPSGKPYPDNWIITDVIYEIEGSLFSRSGNLVEGNPGPTSGDETVPYHSLSWCKNWLGPKVNITRAPQNIKKKQTL***
xxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQMMVPTRRFAVVLVLLLVVLLGVLRDASAKGGEFTGDYPKLSGIIIPGFASTQLRAWSILDCPYSPLDFNPLDLVWLDTTKLLSAVNCWLKCMTLDPYNQTDNPECKSRPDSGLSAITELDPGYITGPLSSVWKEWVKWCIEFGIEANSIIAAPYDWRLSPSKLEERDLYFHKLKLTFETALKLRGGPSLVLAHSLGNNVFRYFLEWLKLEIPPKQYIKWLDEHIHAYFAVGSPFLGATQSVKATLSGETSGLPVSEGTARLMFNSFGSSLWMMPFSKYCRADNKYWKHFSGGTRKDHHIHQCDEQEFRSNYSGWPTNLINIEIPSIRGLEAYPSVSEVAHNNFSSIECGLPTQLSFSAREISDGTFFKAIEDYDPESKRLLHLLEKSYHGDPVLNPLTPWDRPPIKNIFCIYGIDSKTEVGYYFAPSGKPYPDNWIITDVIYEIEGSLFSRSGNLVEGNPGPTSGDETVPYHSLSWCKNWLGPKVNITRAPQNIKKKQTLFPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phospholipid--sterol O-acyltransferase Involved in lipid catabolism. Essential for sterol esters biosynthesis in leaves and seeds, but not in flowers. Plays a role in controlling the free sterol content of leaves. Catalyzes the transacylation of acyl groups from phospholipids to a variety of different sterols. Prefers phosphatidylethanolamine over phosphatidylcholine as an acyl donor. Not active toward neutral lipids. Highly specific for position sn-2, which in plant lipids is essentially devoid of saturated acyl groups. Broad sterol specificity (cholesterol > campesterol > sitosterol > stigmasterol), but no activity with lupeol or beta-amyrin.probableQ4VCM1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DS8, chain A
Confidence level:probable
Coverage over the Query: 132-241
View the alignment between query and template
View the model in PyMOL