BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 010660
(505 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant
In Complex With The Inhibitor
4-(4-Chlorophenyl)imidazole
pdb|3QOA|A Chain A, Crystal Structure Of A Human Cytochrome P450 2b6
(Y226hK262R) IN Complex With The Inhibitor
4-Benzylpyridine.
pdb|3QU8|A Chain A, Crystal Structure Of A Human Cytochrome P450 2b6
(Y226hK262R) IN Complex With The Inhibitor
4-(4-Nitrobenzyl)pyridine.
pdb|3QU8|B Chain B, Crystal Structure Of A Human Cytochrome P450 2b6
(Y226hK262R) IN Complex With The Inhibitor
4-(4-Nitrobenzyl)pyridine.
pdb|3QU8|C Chain C, Crystal Structure Of A Human Cytochrome P450 2b6
(Y226hK262R) IN Complex With The Inhibitor
4-(4-Nitrobenzyl)pyridine.
pdb|3QU8|D Chain D, Crystal Structure Of A Human Cytochrome P450 2b6
(Y226hK262R) IN Complex With The Inhibitor
4-(4-Nitrobenzyl)pyridine.
pdb|3QU8|E Chain E, Crystal Structure Of A Human Cytochrome P450 2b6
(Y226hK262R) IN Complex With The Inhibitor
4-(4-Nitrobenzyl)pyridine.
pdb|3QU8|F Chain F, Crystal Structure Of A Human Cytochrome P450 2b6
(Y226hK262R) IN Complex With The Inhibitor
4-(4-Nitrobenzyl)pyridine.
pdb|3UA5|A Chain A, Crystal Structure Of P450 2b6 (Y226hK262R) IN COMPLEX WITH
TWO Molecules Of Amlodipine
pdb|3UA5|B Chain B, Crystal Structure Of P450 2b6 (Y226hK262R) IN COMPLEX WITH
TWO Molecules Of Amlodipine
Length = 476
Score = 28.9 bits (63), Expect = 7.4, Method: Compositional matrix adjust.
Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 7/38 (18%)
Query: 177 IYQNLQKLDVYLSHMVAKHQK------PRK-ITRYWVH 207
+Y+NLQ+++ Y+ H V KH++ PR I Y +H
Sbjct: 215 VYKNLQEINAYIGHSVEKHRETLDPSAPRDLIDTYLLH 252
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.136 0.397
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,803,868
Number of Sequences: 62578
Number of extensions: 540290
Number of successful extensions: 1178
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1176
Number of HSP's gapped (non-prelim): 8
length of query: 505
length of database: 14,973,337
effective HSP length: 103
effective length of query: 402
effective length of database: 8,527,803
effective search space: 3428176806
effective search space used: 3428176806
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 54 (25.4 bits)