BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010660
         (505 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant
           In Complex With The Inhibitor
           4-(4-Chlorophenyl)imidazole
 pdb|3QOA|A Chain A, Crystal Structure Of A Human Cytochrome P450 2b6
           (Y226hK262R) IN Complex With The Inhibitor
           4-Benzylpyridine.
 pdb|3QU8|A Chain A, Crystal Structure Of A Human Cytochrome P450 2b6
           (Y226hK262R) IN Complex With The Inhibitor
           4-(4-Nitrobenzyl)pyridine.
 pdb|3QU8|B Chain B, Crystal Structure Of A Human Cytochrome P450 2b6
           (Y226hK262R) IN Complex With The Inhibitor
           4-(4-Nitrobenzyl)pyridine.
 pdb|3QU8|C Chain C, Crystal Structure Of A Human Cytochrome P450 2b6
           (Y226hK262R) IN Complex With The Inhibitor
           4-(4-Nitrobenzyl)pyridine.
 pdb|3QU8|D Chain D, Crystal Structure Of A Human Cytochrome P450 2b6
           (Y226hK262R) IN Complex With The Inhibitor
           4-(4-Nitrobenzyl)pyridine.
 pdb|3QU8|E Chain E, Crystal Structure Of A Human Cytochrome P450 2b6
           (Y226hK262R) IN Complex With The Inhibitor
           4-(4-Nitrobenzyl)pyridine.
 pdb|3QU8|F Chain F, Crystal Structure Of A Human Cytochrome P450 2b6
           (Y226hK262R) IN Complex With The Inhibitor
           4-(4-Nitrobenzyl)pyridine.
 pdb|3UA5|A Chain A, Crystal Structure Of P450 2b6 (Y226hK262R) IN COMPLEX WITH
           TWO Molecules Of Amlodipine
 pdb|3UA5|B Chain B, Crystal Structure Of P450 2b6 (Y226hK262R) IN COMPLEX WITH
           TWO Molecules Of Amlodipine
          Length = 476

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 7/38 (18%)

Query: 177 IYQNLQKLDVYLSHMVAKHQK------PRK-ITRYWVH 207
           +Y+NLQ+++ Y+ H V KH++      PR  I  Y +H
Sbjct: 215 VYKNLQEINAYIGHSVEKHRETLDPSAPRDLIDTYLLH 252


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,803,868
Number of Sequences: 62578
Number of extensions: 540290
Number of successful extensions: 1178
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1176
Number of HSP's gapped (non-prelim): 8
length of query: 505
length of database: 14,973,337
effective HSP length: 103
effective length of query: 402
effective length of database: 8,527,803
effective search space: 3428176806
effective search space used: 3428176806
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 54 (25.4 bits)