BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010694
         (503 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1ZJJ|A Chain A, Crystal Structure Of Hypothetical Protein Ph1952 From
           Pyrococcus Horikoshii Ot3
 pdb|1ZJJ|B Chain B, Crystal Structure Of Hypothetical Protein Ph1952 From
           Pyrococcus Horikoshii Ot3
          Length = 263

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 148 GIWKGVGAVFSPM--TAEMEPIEIGKKNENLYDC 179
           GI+ G G++ + +     +EPI IGK NE +Y+ 
Sbjct: 162 GIYPGAGSIIAALKVATNVEPIIIGKPNEPMYEV 195


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.131    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,811,620
Number of Sequences: 62578
Number of extensions: 613396
Number of successful extensions: 1074
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1074
Number of HSP's gapped (non-prelim): 4
length of query: 503
length of database: 14,973,337
effective HSP length: 103
effective length of query: 400
effective length of database: 8,527,803
effective search space: 3411121200
effective search space used: 3411121200
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 53 (25.0 bits)