BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 010740
(502 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From
A. Thaliana With Mn
pdb|4G26|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From
A. Thaliana With Ca
Length = 501
Score = 32.3 bits (72), Expect = 0.67, Method: Compositional matrix adjust.
Identities = 17/58 (29%), Positives = 25/58 (43%)
Query: 142 PKEGTYMKLLVLLGKSGQPELARKVFNEMVEEGIEPTPELYTALLAAYCRNSLIDEAF 199
P E T+ L PE+A + +M GI+P Y L +CR D+A+
Sbjct: 103 PNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAY 160
>pdb|2VK9|A Chain A, Crystal Structure Of The Catalytic Domain Of Alpha-Toxin
From Clostridium Novyi
Length = 551
Score = 28.9 bits (63), Expect = 7.8, Method: Compositional matrix adjust.
Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
Query: 325 NILIGAYGKKRMY-DKMSSVMEYMRKLQFPWTSSTYNNVIE 364
NIL G YG + Y D+M + Y R+L+ + + NN ++
Sbjct: 162 NILDGTYGHNKFYSDRMKLIYRYKRELKMLYENMKQNNSVD 202
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.131 0.390
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,538,145
Number of Sequences: 62578
Number of extensions: 524566
Number of successful extensions: 1304
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1299
Number of HSP's gapped (non-prelim): 7
length of query: 502
length of database: 14,973,337
effective HSP length: 103
effective length of query: 399
effective length of database: 8,527,803
effective search space: 3402593397
effective search space used: 3402593397
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)