BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010742
         (502 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CLV|A Chain A, Crystal Structure Of Rab5a From Plasmodium Falciparum,
           Pfb0500c
          Length = 208

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 7/73 (9%)

Query: 60  VLSDESDSVREN---IGFDISDLASEKEYA-VAFVYFKTRYAAIVAAEVLHS---ENPML 112
           +++++ ++  EN   I FDI D A ++ YA +  +Y++    AIV  ++ +S   +    
Sbjct: 78  IITNQHNNYNENLCNIKFDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNTLDRAKT 137

Query: 113 WVTELAPEPNDVL 125
           WV +L    N ++
Sbjct: 138 WVNQLKISSNYII 150


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.137    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,747,272
Number of Sequences: 62578
Number of extensions: 451566
Number of successful extensions: 1314
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1314
Number of HSP's gapped (non-prelim): 1
length of query: 502
length of database: 14,973,337
effective HSP length: 103
effective length of query: 399
effective length of database: 8,527,803
effective search space: 3402593397
effective search space used: 3402593397
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)