Citrus Sinensis ID: 010751


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--
MKETCVSFSSSSRYSAKISQVLHLDNAGIGIRRGRRSIVAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFEFGTLHPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQKASTLLSSRGNKAYHLNLAVSLSLVVHLLKLCIKLVLRLIHTYISAAGGMVKAVAEEMGIGFLGIGFQPKWGLKDIPVMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGYLSMRSHIWTDTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY
cccccccccccccccccccEEEccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccEEEEECcccEEccccccccHHHHHHHHHHHHHHccccccccccEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccCEECcccccccccccccccccHHHHHHHHHHHccccccHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHccccccccccccccccccccHHHHHHHHHccccEEEEEcccccccccccHHHHHccccccccccccccHHHHHHHccccccccccccEEECccccccccccccHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHcHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHccccccccHHHHHHHcc
**********************************RRSIVAA***TEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFEFGTLHPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQKASTLLSSRGNKAYHLNLAVSLSLVVHLLKLCIKLVLRLIHTYISAAGGMVKAVAEEMGIGFLGIGFQPKWGLKDIPVMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGYLSMRSHIWTDTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKETCVSFSSSSRYSAKISQVLHLDNAGIGIRRGRRSIVAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFEFGTLHPMKYEQIAELLNSIAERFDWEKVMEGDYIIGLKQKASTLLSSRGNKAYHLNLAVSLSLVVHLLKLCIKLVLRLIHTYISAAGGMVKAVAEEMGIGFLGIGFQPKWGLKDIPVMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGYLSMRSHIWTDTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate--cysteine ligase A, chloroplastic confidentQ688Q9
Glutamate--cysteine ligase B, chloroplastic confidentQ6Z3A3
Glutamate--cysteine ligase, chloroplastic Seems to play an important role in controlling the expression of resistance responses like the regulation of salicylic acid (SA) and phytoalexin (camalexin) production. Involved in resistance to fungal and bacterial pathogens. Required for the regulation of cell proliferation in root apical meristems through the GSH-dependent developmental pathway. Also participates to the detoxification process, the antioxidant response and is essential for embryo development and proper seed maturation.confidentP46309

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.2Glutamate--cysteine ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GWD, chain A
Confidence level:very confident
Coverage over the Query: 53-502
View the alignment between query and template
View the model in PyMOL