Citrus Sinensis ID: 010759


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--
MEANLTCQSDVDMDEDFSFLQPMDLITKDVCELRQMVKEKKKNLNGDRDKENDVDRGHEIEHGRVKEKERLDREKERERDKERVENEKEPEKQHESHPDKEMLTVQEEKVNSKPEENGVLQGEKGPEPMDIATTSASESFEIPNSDVTILEGHTSEVCACAWSPAGSLLASGSGDSTARIWTIADGTSNGGAQNGPLNVLVLKHVKGRTNEKSKDVTTLDWNGEGTLLATGSYDGQARIWSTNGDLKCTLSKHKGPIFSLKWNKKGDYLLTGSCDKTAIVWDVKTEEWKQQFEFHSGPTLDVDWRNNVSFATSSTDNMIYVCKIGENRPIKTFAGHQGEVNCVKWDPTGSLLASCSDDVTAKIWNMKQDKYVHDLREHSKEIYTIRWSPTGSGTNNPNQQLILASASFDSTVKLWDVELGKLLYSLNGHREPVYSLAFSPTGEYLASGSLDKSMHIWSLKEGKIVKTYTGNGGIFEVCWNKEGDKIAACFANHTVCVLDFRM
cccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccccccccccEEEEEEcccccEEEECcccccEEEccccccccccccccEEEEEEcccccEEEEccccccEEEEEcccccccccccccccccEEEEccccccccccccEEEEEEcccccEEEEECccccEEEEccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEcccccccEEEEEEccccEEEEECccccEEEEEccccCEEEccccccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEcccccccEEEEEEccccccccccccccEEEEccccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEEECcccEEEEEEcccccEEEEEEccccEEEEEEcc
********SDVDMDEDFSFLQPMDLITKDVCELR******************************VKEKERLDR*********************ESHPDKEMLTVQEEKVNSKPEENGVLQGEKGPEPMDIATTSASESFEIPNSDVTILEGHTSEVCACAWSPAGSLLASGSGDSTARIWTIADGTSNGGAQNGPLNVLVLKHVKGRTNEKSKDVTTLDWNGEGTLLATGSYDGQARIWSTNGDLKCTLSKHKGPIFSLKWNKKGDYLLTGSCDKTAIVWDVKTEEWKQQFEFHSGPTLDVDWRNNVSFATSSTDNMIYVCKIGENRPIKTFAGHQGEVNCVKWDPTGSLLASCSDDVTAKIWNMKQDKYVHDLREHSKEIYTIRWSPTGSGTNNPNQQLILASASFDSTVKLWDVELGKLLYSLNGHREPVYSLAFSPTGEYLASGSLDKSMHIWSLKEGKIVKTYTGNGGIFEVCWNKEGDKIAACFANHTVCVLDFRM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEANLTCQSDVDMDEDFSFLQPMDLITKDVCELRQMVKEKKKNLNGDRDKENDVDRGHEIEHGRVKExxxxxxxxxxxxxxxxxxxxxEPEKQHESHPDKEMLTVQEEKVNSKPEENGVLQGEKGPEPMDIATTSASESFEIPNSDVTILEGHTSEVCACAWSPAGSLLASGSGDSTARIWTIADGTSNGGAQNGPLNVLVLKHVKGRTNEKSKDVTTLDWNGEGTLLATGSYDGQARIWSTNGDLKCTLSKHKGPIFSLKWNKKGDYLLTGSCDKTAIVWDVKTEEWKQQFEFHSGPTLDVDWRNNVSFATSSTDNMIYVCKIGENRPIKTFAGHQGEVNCVKWDPTGSLLASCSDDVTAKIWNMKQDKYVHDLREHSKEIYTIRWSPTGSGTNNPNQQLILASASFDSTVKLWDVELGKLLYSLNGHREPVYSLAFSPTGEYLASGSLDKSMHIWSLKEGKIVKTYTGNGGIFEVCWNKEGDKIAACFANHTVCVLDFRM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box-like/WD repeat-containing protein TBL1XR1 F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of the N-Cor corepressor complex that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of N-Cor complex, thereby allowing cofactor exchange, and transcription activation.probableQ8BHJ5
F-box-like/WD repeat-containing protein TBL1XR1 F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of the N-Cor corepressor complex that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of N-Cor complex, thereby allowing cofactor exchange, and transcription activation.probableQ9BZK7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PBI, chain B
Confidence level:very confident
Coverage over the Query: 145-189,203-458
View the alignment between query and template
View the model in PyMOL
Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 145-189,201-501
View the alignment between query and template
View the model in PyMOL
Template: 2XL2, chain A
Confidence level:confident
Coverage over the Query: 243-471
View the alignment between query and template
View the model in PyMOL