Citrus Sinensis ID: 010761

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--

MGTLKPPTLPTRTHILKAPLLHSTFNPQLHTLFNRCITLSSTISCKLRTSQDVKKKKDNVSKKIVFSDSSPPSLKNDEVSGEVESKNGVIGLVKRLPRRVLAALSNLPLAIGEMAAIAALMALGTAIEQGEVPDFYFQKYPEDNPVFGFFTWRWILTLGFDHMFSSPIFLGLLVMMGLSLMACTYTTQIPLVKVARRWSFLHSAEAIRKQEFSDTLPRASIQDLGVILMGAGYEVFLKGPSLYAFKGLVGRFAPIGVHLAMLLIMAGGTLSATGSFRGSVTVPQGLNFVVGDVLGPNGFLSTPTDAFSTEVHVNKFYMDYYDSGEVKQFHSDLSLFDIGGKEVMRKTISVNDPLRYGGITIYQTDWSFSALQVLKNDEGPFNLAMAPLKVNGDKKLFGTFLPLGDVNSPNVKGISMLARDLQSIVIYDQEGKFTGVRRPNSKLPIDIDGTKIVIVDAIGSTGLDLKTDPGVPIVYAGFGALMLTTCISFLSHTQVKLQFLEL

ccccccccccccccccccccccccccccccccccccEEEEEEEEEECccccccccccccccccEEcccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHcccEEECccccHHHHHHccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHcccccccccHHHHHHHHHHHHHcccEEEECccEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccCEEEEEEccccEEEEEECcccccccccccccccEEEEEccEEEccccccccccCEEEEEEECccccEEEEEEEEEcccEEEccEEEEEccccccEEEEEEccccccccccccccccccCEEEEEEECcccccccccccccccccccccEEEEcccccEEEEEcccccccCECccEEEEEEccccCEEEEEccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEc

*******TLPTRTHILKAPLLHSTFNPQLHTLFNRCITLSSTISCKL****************************************GVIGLVKRLPRRVLAALSNLPLAIGEMAAIAALMALGTAIEQGEVPDFYFQKYPEDNPVFGFFTWRWILTLGFDHMFSSPIFLGLLVMMGLSLMACTYTTQIPLVKVARRWSFLHSAEAIRKQEFSDTLPRASIQDLGVILMGAGYEVFLKGPSLYAFKGLVGRFAPIGVHLAMLLIMAGGTLSATGSFRGSVTVPQGLNFVVGDVLGPNGFLSTPTDAFSTEVHVNKFYMDYYDSGEVKQFHSDLSLFDIGGKEVMRKTISVNDPLRYGGITIYQTDWSFSALQVLKNDEGPFNLAMAPLKVNGDKKLFGTFLPLGDVNSPNVKGISMLARDLQSIVIYDQEGKFTGVRRPNSKLPIDIDGTKIVIVDAIGSTGLDLKTDPGVPIVYAGFGALMLTTCISFLSHTQVKLQFLEL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome c biogenesis protein CCS1, chloroplastic	Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment.	confident	Q9XIA4
Cytochrome c biogenesis protein CCS1, chloroplastic	Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment.	probable	Q75KA9
Cytochrome c biogenesis protein CcsB	Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment.	probable	Q118K5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!