BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010795
         (501 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1LHS|A Chain A, Loggerhead Sea Turtle Myoglobin (Aquo-Met)
 pdb|1LHT|A Chain A, Loggerhead Sea Turtle Myoglobin (Cyano-Met)
          Length = 153

 Score = 29.3 bits (64), Expect = 5.7,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 6/42 (14%)

Query: 439 LFVLHPHTREHSSK------IEWVKSRDELKGNGSSMIEGRG 474
           LF LHP T+E  +K      I+ +KS +E+K +G++++   G
Sbjct: 32  LFQLHPETQERFAKFKNLTTIDALKSSEEVKKHGTTVLTALG 73


>pdb|1MNJ|A Chain A, Interactions Among Residues Cd3, E7, E10 And E11 In
           Myoglobins: Attempts To Simulate The O2 And Co Binding
           Properties Of Aplysia Myoglobin
 pdb|1MNJ|B Chain B, Interactions Among Residues Cd3, E7, E10 And E11 In
           Myoglobins: Attempts To Simulate The O2 And Co Binding
           Properties Of Aplysia Myoglobin
          Length = 153

 Score = 28.5 bits (62), Expect = 9.7,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 6/44 (13%)

Query: 439 LFVLHPHTREHSSKIEWVKSRDELKGN------GSSMIEGRGGL 476
           LF  HP T E   K + +KS DE+K +      G++++   GG+
Sbjct: 32  LFKGHPETLEKFDKFKHLKSEDEMKASEDLKKVGNTILTALGGI 75


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.139    0.440 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,029,611
Number of Sequences: 62578
Number of extensions: 691790
Number of successful extensions: 1330
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1329
Number of HSP's gapped (non-prelim): 3
length of query: 501
length of database: 14,973,337
effective HSP length: 103
effective length of query: 398
effective length of database: 8,527,803
effective search space: 3394065594
effective search space used: 3394065594
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (25.0 bits)