BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 010795
(501 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q9NRA1|PDGFC_HUMAN Platelet-derived growth factor C OS=Homo sapiens GN=PDGFC PE=1
SV=2
Length = 345
Score = 33.1 bits (74), Expect = 4.9, Method: Compositional matrix adjust.
Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 7/68 (10%)
Query: 1 MESKAQSSYSSRLNRRGDRNHQTLRTQDAEVGLFSPRFPQDYPMK--IVWKRGFIRLVLV 58
+ SK Q S + N D H+ + T + SPRFP YP +VW RLV V
Sbjct: 26 LSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVW-----RLVAV 80
Query: 59 AGIAWMLL 66
W+ L
Sbjct: 81 EENVWIQL 88
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.323 0.139 0.440
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 197,897,805
Number of Sequences: 539616
Number of extensions: 8604664
Number of successful extensions: 16021
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 16020
Number of HSP's gapped (non-prelim): 12
length of query: 501
length of database: 191,569,459
effective HSP length: 122
effective length of query: 379
effective length of database: 125,736,307
effective search space: 47654060353
effective search space used: 47654060353
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 63 (28.9 bits)