Citrus Sinensis ID: 010809


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500
MEASSACLVGNILTTHKTKTNLSKDFHGRHLLFNSSFRSLEKKPKVAVVKASLSQKQHEGRRGFLKKLVGNVGVGTALLGSGKAYADEQGVSSSRMSYSRFLEYLDKDRVKKVDLFENGTIAIVEAISPELGNRVQRVRVQLPGLSQELLQKFREKNIDFAAHNAQEDSGSLLFNLIGNLAFPLILIGGLFLLSRRSSGGMGGPGGPGFPLAFGQSKAKFQMEPNTGVTFDDVAGVDEAKQDFMEVVEFLKKPERFTAIGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGADLANLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICG
cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccEEEEEEEcccEEEEEEEcccccccccEEEEEEcccccHHHHHHHHHccccEEECccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHccccHHHHHcccccccccEEEccccccHHHHHHHHHccccccEEEcccccEEEEcccccHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccHHEEEcccccccc
******CLVGNILTTHKTKTNLSKDFHGRHLLFNSSF************************RGFLKKLVGNVGVGTALLGSGKA***********MSYSRFLEYLDKDRVKKVDLFENGTIAIVEAISPELGNRVQRVRVQLPGLSQELLQKFREKNIDFAAHNAQEDSGSLLFNLIGNLAFPLILIGGLFLLS******************************NTGVTFDDVAGVDEAKQDFMEVVEFLKKPERFTAIGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGADLANLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMT*****SLVAYHEVGHAICG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEASSACLVGNILTTHKTKTNLSKDFHGRHLLFNSSFRSLEKKPKVAVVKASLSQKQHEGRRGFLKKLVGNVGVGTALLGSGKAYADEQGVSSSRMSYSRFLEYLDKDRVKKVDLFENGTIAIVEAISPELGNRVQRVRVQLPGLSQELLQKFREKNIDFAAHNAQEDSGSLLFNLIGNLAFPLILIGGLFLLSRRSSGGMGGPGGPGFPLAFGQSKAKFQMEPNTGVTFDDVAGVDEAKQDFMEVVEFLKKPERFTAIGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLDVIAMRTPGFSGADLANLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent zinc metalloprotease FTSH 2, chloroplastic Probable ATP-dependent zinc metallopeptidase.confidentQ655S1
ATP-dependent zinc metalloprotease FtsH Acts as a processive, ATP-dependent zinc metallopeptidase.probableO78516
ATP-dependent zinc metalloprotease FTSH 2, chloroplastic Part of a complex that function as an ATP-dependent zinc metallopeptidase. Involved in the thylakoid formation and in the removal of damaged D1 in the photosystem II, preventing cell death under high-intensity light conditions, but not involved in thermotolerance.probableO80860

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DHR, chain A
Confidence level:very confident
Coverage over the Query: 217-500
View the alignment between query and template
View the model in PyMOL
Template: 2LNA, chain A
Confidence level:probable
Coverage over the Query: 92-156
View the alignment between query and template
View the model in PyMOL