Citrus Sinensis ID: 010834

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MDTGGNSLPSGTDGVKRKVCYFYDPEVGNYYYGQGHPMKPHRIRMTHALLAHYGLLQNMQVLKPFPARERDLCRFHADDYVSFLRSITPETQQDQLRQLKRFNVGEDCPVFDGLFSFCQTYAGGSVGGAVKLNHGLCDIAINWAGGLHHAKKCEASGFCYVNDIVLAILELLKQHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDIGYSKGKFYSLNVPLDDGIDDESYHYLFKPIIGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVKFMRSFNVPLLLLGGGGYTIRNVARCWCYETGVALGVEVDDKMPQHEYYEYFGPDYTLHVAPSNMENKNSRQLLEEIRNKLLEYLSKLQHAPSVQFQERPPDSELPEADEDQEDGDERWDPDSDMDVDDERKSLPNRVKREAVEPEQKDREGLKGMAEQARGFDMIADDSISTKVLDMSSMPIDEPSIKVEQENMSKASDHMYPHS
ccccccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHccccccccccccccccHHHHHccccHHHHHHHHHcccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccHHHHHHHHHHHHccEEEEEEcccccccccHHcccccccEEEEccccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHccccCEEEcccccccccHHHHHHHHHHHHccccccccccccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHccccHHHccccccccccccHccccccccccccccccccccccccccccccccccccccHHccccccccccccccc
**************VKRKVCYFYDPEVGNYYYGQGHPMKPHRIRMTHALLAHYGLLQNMQVLKPFPARERDLCRFHADDYVSFLRSITPETQQDQLRQLKRFNVGEDCPVFDGLFSFCQTYAGGSVGGAVKLNHGLCDIAINWAGGLHHAKKCEASGFCYVNDIVLAILELLKQHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDIGYSKGKFYSLNVPLDDGIDDESYHYLFKPIIGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVKFMRSFNVPLLLLGGGGYTIRNVARCWCYETGVALGVEVDDKMPQHEYYEYFGPDYTLHVAPSNMENKNSRQLLEEIRNKLLEYLSKLQHAPSVQFQERP**********************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTGGNSLPSGTDGVKRKVCYFYDPEVGNYYYGQGHPMKPHRIRMTHALLAHYGLLQNMQVLKPFPARERDLCRFHADDYVSFLRSITPETQQDQLRQLKRFNVGEDCPVFDGLFSFCQTYAGGSVGGAVKLNHGLCDIAINWAGGLHHAKKCEASGFCYVNDIVLAILELLKQHERVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDIGYSKGKFYSLNVPLDDGIDDESYHYLFKPIIGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVKFMRSFNVPLLLLGGGGYTIRNVARCWCYETGVALGVEVDDKMPQHEYYEYFGPDYTLHVAPSNMExxxxxxxxxxxxxxxxxxxxxLQHAPSVQFQERPPDSELPEADEDQEDGDERWDPDSDMDVDDERKSLPNRVKREAVEPEQKDREGLKGMAEQARGFDMIADDSISTKVLDMSSMPIDEPSIKVEQENMSKASDHMYPHS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone deacetylase 19 Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDA19 is involved in jasmonic acid and ethylene signaling of pathogen response.confidentO22446
Type-1 histone deacetylase 1 Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.probableQ55FN5
Probable histone deacetylase 19 Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.probableP56521

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.5.-.-Acting on carbon-nitrogen bonds, other than peptide bonds.probable
3.5.1.-11-cis-retinol dehydrogenase.probable
3.5.1.98Histone deacetylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A69, chain A
Confidence level:very confident
Coverage over the Query: 16-382
View the alignment between query and template
View the model in PyMOL