Query         010849
Match_columns 499
No_of_seqs    304 out of 1641
Neff          5.8 
Searched_HMMs 46136
Date          Fri Mar 29 05:16:10 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/010849.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/010849hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12315 DUF3633:  Protein of u 100.0 1.1E-85 2.4E-90  624.1  20.4  209  287-495     1-212 (212)
  2 KOG1703 Adaptor protein Enigma  99.9 9.9E-29 2.1E-33  266.2   5.1  336  133-498   132-479 (479)
  3 KOG1701 Focal adhesion adaptor  99.8 2.8E-22   6E-27  206.5   0.1  157   97-267   294-462 (468)
  4 KOG4577 Transcription factor L  99.7 4.6E-20 9.9E-25  181.7  -3.7  125  133-269    31-155 (383)
  5 KOG2272 Focal adhesion protein  99.7 1.4E-18 2.9E-23  168.8  -2.1  162   89-267    24-193 (332)
  6 KOG2272 Focal adhesion protein  99.7 2.7E-18 5.9E-23  166.7  -0.3  148  105-267   165-312 (332)
  7 KOG1703 Adaptor protein Enigma  99.7 4.1E-18 8.8E-23  184.1   0.3  154   97-264   322-478 (479)
  8 KOG1701 Focal adhesion adaptor  99.7 3.7E-18 8.1E-23  176.2  -2.5  123  131-269   270-394 (468)
  9 KOG1044 Actin-binding LIM Zn-f  99.5 1.9E-15 4.1E-20  160.8   3.0  123  131-268   129-251 (670)
 10 PF00412 LIM:  LIM domain;  Int  99.2 8.7E-12 1.9E-16   96.3   4.9   57  138-194     1-58  (58)
 11 KOG1044 Actin-binding LIM Zn-f  99.1 1.1E-10 2.4E-15  125.0   4.8  111  135-270    16-126 (670)
 12 KOG4577 Transcription factor L  98.6 4.1E-09 8.9E-14  104.9  -2.0  103   97-199    52-159 (383)
 13 KOG1700 Regulatory protein MLP  98.6 1.7E-08 3.6E-13   97.9   1.0  121  135-269     7-168 (200)
 14 PF00412 LIM:  LIM domain;  Int  98.3 5.3E-07 1.1E-11   69.4   4.0   57  198-267     1-57  (58)
 15 smart00132 LIM Zinc-binding do  98.2 1.2E-06 2.6E-11   61.5   3.1   37  137-173     1-38  (39)
 16 PF13485 Peptidase_MA_2:  Pepti  97.3 0.00049 1.1E-08   59.5   6.2  108  371-493    18-127 (128)
 17 KOG0490 Transcription factor,   96.8 0.00017 3.6E-09   70.1  -1.7  115  140-267     1-119 (235)
 18 KOG1700 Regulatory protein MLP  96.6 0.00055 1.2E-08   66.6   0.1   62  134-195   107-168 (200)
 19 smart00132 LIM Zinc-binding do  96.5  0.0022 4.7E-08   44.7   2.8   37  197-244     1-37  (39)
 20 KOG1702 Nebulin repeat protein  96.4 0.00037   8E-09   67.3  -2.3   59  136-194     5-63  (264)
 21 PF10026 DUF2268:  Predicted Zn  91.7    0.66 1.4E-05   44.8   7.7   45  376-420    63-113 (195)
 22 PF01433 Peptidase_M1:  Peptida  86.5     0.5 1.1E-05   49.4   2.8   44  377-420   294-339 (390)
 23 PF04450 BSP:  Peptidase of pla  82.3     1.5 3.3E-05   42.9   3.9   91  375-484    93-184 (205)
 24 PF14891 Peptidase_M91:  Effect  81.4       1 2.2E-05   42.7   2.3   20  377-396   102-121 (174)
 25 PF13699 DUF4157:  Domain of un  81.0    0.94   2E-05   37.7   1.7   18  378-395    61-78  (79)
 26 PF06114 DUF955:  Domain of unk  80.9     2.3 4.9E-05   36.0   4.1   52  365-416    29-86  (122)
 27 PF01431 Peptidase_M13:  Peptid  80.7    0.67 1.4E-05   44.5   0.8   17  377-393    35-51  (206)
 28 PF10263 SprT-like:  SprT-like   80.2     1.3 2.8E-05   40.6   2.5   22  373-394    55-76  (157)
 29 TIGR02412 pepN_strep_liv amino  80.1     8.3 0.00018   45.3   9.7   42  378-419   287-330 (831)
 30 PRK03001 M48 family peptidase;  77.9    0.96 2.1E-05   46.1   1.0   20  372-391   118-137 (283)
 31 PRK01345 heat shock protein Ht  76.5     1.2 2.5E-05   46.5   1.2   19  373-391   119-137 (317)
 32 PRK02391 heat shock protein Ht  74.7     1.3 2.8E-05   45.8   0.9   21  371-391   126-146 (296)
 33 KOG1702 Nebulin repeat protein  74.4    0.57 1.2E-05   45.7  -1.6   97  195-310     4-112 (264)
 34 PRK03072 heat shock protein Ht  73.2     1.3 2.8E-05   45.5   0.5   21  370-390   119-139 (288)
 35 PF10460 Peptidase_M30:  Peptid  72.6     4.8  0.0001   42.9   4.5   44  376-419   137-186 (366)
 36 smart00731 SprT SprT homologue  70.8     3.6 7.8E-05   37.8   2.8   22  374-395    55-76  (146)
 37 PRK14015 pepN aminopeptidase N  70.5      15 0.00032   43.7   8.3   41  378-419   296-339 (875)
 38 PRK02870 heat shock protein Ht  68.6     1.9 4.2E-05   45.3   0.6   18  372-389   167-184 (336)
 39 PRK03982 heat shock protein Ht  68.3     1.9 4.1E-05   44.1   0.4   20  372-391   119-138 (288)
 40 COG2856 Predicted Zn peptidase  68.1      11 0.00023   37.4   5.6   55  365-419    59-120 (213)
 41 PRK04897 heat shock protein Ht  67.5     1.9   4E-05   44.5   0.2   20  371-390   130-149 (298)
 42 PRK05457 heat shock protein Ht  67.0     2.3   5E-05   43.6   0.7   21  370-390   126-146 (284)
 43 KOG0490 Transcription factor,   66.5       2 4.3E-05   41.6   0.1   94   98-192    16-118 (235)
 44 KOG0320 Predicted E3 ubiquitin  65.8     3.5 7.6E-05   39.6   1.7   48  160-207   129-179 (187)
 45 PF09768 Peptidase_M76:  Peptid  65.4     4.6  0.0001   38.6   2.4   22  374-395    67-88  (173)
 46 PRK01265 heat shock protein Ht  65.2     2.5 5.4E-05   44.3   0.6   17  373-389   135-151 (324)
 47 PHA02456 zinc metallopeptidase  62.4     4.8  0.0001   35.9   1.7   15  380-394    81-95  (141)
 48 PF14835 zf-RING_6:  zf-RING of  61.1       8 0.00017   31.2   2.6   46  163-208     8-53  (65)
 49 PRK14559 putative protein seri  60.2     7.3 0.00016   44.6   3.2   49  136-206     2-52  (645)
 50 PF01447 Peptidase_M4:  Thermol  58.4     6.1 0.00013   36.8   1.8   18  374-391   131-148 (150)
 51 TIGR02411 leuko_A4_hydro leuko  57.5     8.8 0.00019   43.5   3.2   40  379-418   280-321 (601)
 52 cd04270 ZnMc_TACE_like Zinc-de  57.3     6.6 0.00014   39.3   2.0   18  373-390   162-179 (244)
 53 PF10083 DUF2321:  Uncharacteri  56.7     7.5 0.00016   36.6   2.1   54  182-248    27-82  (158)
 54 PRK04351 hypothetical protein;  56.5     9.7 0.00021   35.5   2.8   20  376-395    59-78  (149)
 55 PF06524 NOA36:  NOA36 protein;  55.7     9.8 0.00021   38.7   2.8  110  105-242    40-179 (314)
 56 PF01435 Peptidase_M48:  Peptid  54.6       9 0.00019   36.6   2.4   23  373-395    84-106 (226)
 57 smart00726 UIM Ubiquitin-inter  54.3       7 0.00015   25.9   1.0   20   77-96      2-21  (26)
 58 smart00504 Ubox Modified RING   54.1      15 0.00032   28.1   3.1   44  163-207     2-47  (63)
 59 PF02809 UIM:  Ubiquitin intera  53.6     7.1 0.00015   23.7   0.9   16   76-91      2-17  (18)
 60 PF04298 Zn_peptidase_2:  Putat  53.1      12 0.00027   37.2   3.0   29  371-399    82-110 (222)
 61 PRK11827 hypothetical protein;  52.4     9.5 0.00021   30.4   1.7   18  287-304    33-50  (60)
 62 PF14471 DUF4428:  Domain of un  52.3     8.5 0.00018   29.5   1.4   30  236-267     1-30  (51)
 63 PF11781 RRN7:  RNA polymerase   51.6     9.8 0.00021   27.1   1.5   25  235-265     9-33  (36)
 64 KOG1813 Predicted E3 ubiquitin  51.2       8 0.00017   39.9   1.4   46  162-208   241-288 (313)
 65 PF02163 Peptidase_M50:  Peptid  49.9      15 0.00032   34.7   3.0   20  377-396     6-26  (192)
 66 PF01421 Reprolysin:  Reprolysi  49.6      17 0.00038   34.6   3.5   24  366-389   119-142 (199)
 67 PF10367 Vps39_2:  Vacuolar sor  49.3      11 0.00024   31.9   1.8   30  134-163    77-107 (109)
 68 KOG3931 Uncharacterized conser  48.8     9.5 0.00021   40.3   1.6   22  373-394   100-121 (484)
 69 PRK04860 hypothetical protein;  48.8      19 0.00042   34.0   3.5   28  374-402    59-89  (160)
 70 PF13920 zf-C3HC4_3:  Zinc fing  48.2      22 0.00048   26.3   3.1   42  164-206     4-48  (50)
 71 PF12773 DZR:  Double zinc ribb  47.4      22 0.00048   26.3   3.0   11  197-207    31-41  (50)
 72 cd06158 S2P-M50_like_1 Unchara  46.1      18 0.00039   34.6   2.9   18  377-394     8-25  (181)
 73 smart00235 ZnMc Zinc-dependent  45.8      10 0.00023   33.9   1.2   11  380-390    88-98  (140)
 74 PF10463 Peptidase_U49:  Peptid  45.8      27 0.00059   34.4   4.2   50  372-421    95-145 (206)
 75 cd04267 ZnMc_ADAM_like Zinc-de  45.2      13 0.00028   35.2   1.7   24  366-390   122-145 (192)
 76 TIGR02414 pepN_proteo aminopep  44.5      79  0.0017   37.6   8.4   36  378-418   283-325 (863)
 77 PF01863 DUF45:  Protein of unk  43.6      15 0.00032   35.0   1.9   25  366-390   152-176 (205)
 78 PRK14890 putative Zn-ribbon RN  43.5      25 0.00054   28.0   2.8   28  135-171     7-34  (59)
 79 cd04268 ZnMc_MMP_like Zinc-dep  43.0      13 0.00029   33.9   1.5   14  377-390    93-106 (165)
 80 COG5152 Uncharacterized conser  42.0     9.2  0.0002   37.4   0.2   45  162-207   196-242 (259)
 81 PF10367 Vps39_2:  Vacuolar sor  42.0      24 0.00051   29.8   2.8   28  164-191    80-108 (109)
 82 PF00645 zf-PARP:  Poly(ADP-rib  41.5     6.9 0.00015   32.2  -0.6   18  132-149     4-21  (82)
 83 KOG3624 M13 family peptidase [  40.5      13 0.00029   42.5   1.3   15  377-391   517-531 (687)
 84 COG4357 Zinc finger domain con  40.2     4.2   9E-05   35.3  -2.1   49  138-186    38-86  (105)
 85 cd00203 ZnMc Zinc-dependent me  40.0      19 0.00041   32.8   2.0   16  375-390    93-108 (167)
 86 PF00413 Peptidase_M10:  Matrix  39.8      19 0.00041   32.4   1.9   17  373-389   100-116 (154)
 87 PF04228 Zn_peptidase:  Putativ  39.8      23  0.0005   36.6   2.8   21  375-395   167-187 (292)
 88 KOG3714 Meprin A metalloprotea  39.7      14  0.0003   40.0   1.1   14  380-393   161-174 (411)
 89 PRK14873 primosome assembly pr  39.6      18  0.0004   41.5   2.2   55  338-393   501-558 (665)
 90 PF14634 zf-RING_5:  zinc-RING   38.8      30 0.00064   25.1   2.5   39  165-203     2-44  (44)
 91 cd00162 RING RING-finger (Real  38.7      25 0.00054   24.1   2.0   40  165-204     2-44  (45)
 92 COG5504 Predicted Zn-dependent  38.3      39 0.00085   34.4   4.0   39  379-418   141-186 (280)
 93 PF14247 DUF4344:  Domain of un  38.2      51  0.0011   32.8   4.8   39  377-417    91-129 (220)
 94 cd06159 S2P-M50_PDZ_Arch Uncha  38.1      26 0.00056   35.7   2.8   27  370-397   111-138 (263)
 95 cd06162 S2P-M50_PDZ_SREBP Ster  37.5      23  0.0005   36.4   2.3   18  377-394   134-151 (277)
 96 cd06161 S2P-M50_SpoIVFB SpoIVF  36.9      32 0.00068   33.5   3.1   21  376-396    36-57  (208)
 97 PF10235 Cript:  Microtubule-as  36.3      23 0.00051   30.4   1.8   36  164-207    46-81  (90)
 98 PHA00527 hypothetical protein   36.2 1.3E+02  0.0029   26.7   6.4   47  364-415    64-113 (129)
 99 PRK09672 phage exclusion prote  35.9      50  0.0011   34.4   4.4   50  371-420   158-208 (305)
100 PRK04023 DNA polymerase II lar  35.9      40 0.00087   40.4   4.1   52  134-208   625-676 (1121)
101 cd05709 S2P-M50 Site-2 proteas  35.9      26 0.00057   32.8   2.3   20  377-396     7-27  (180)
102 COG1451 Predicted metal-depend  35.8      21 0.00045   35.5   1.6   27  364-390   161-187 (223)
103 COG0501 HtpX Zn-dependent prot  35.3      22 0.00047   35.8   1.7   19  372-390   151-169 (302)
104 TIGR02289 M3_not_pepF oligoend  35.2      46   0.001   37.2   4.4   45  376-420   335-389 (549)
105 PF13688 Reprolysin_5:  Metallo  34.9      25 0.00053   33.2   2.0   20  374-393   138-157 (196)
106 cd06164 S2P-M50_SpoIVFB_CBS Sp  34.7      33 0.00072   34.0   2.9   21  376-396    51-72  (227)
107 PF13240 zinc_ribbon_2:  zinc-r  34.3      25 0.00054   22.5   1.3    9  138-146     2-10  (23)
108 PF05299 Peptidase_M61:  M61 gl  33.6      14  0.0003   33.4   0.0   41  378-418     4-57  (122)
109 cd04281 ZnMc_BMP1_TLD Zinc-dep  33.5      22 0.00047   34.8   1.3   11  380-390    89-99  (200)
110 PF14471 DUF4428:  Domain of un  32.7      29 0.00063   26.5   1.6   29  164-193     1-30  (51)
111 COG1645 Uncharacterized Zn-fin  32.4      24 0.00052   32.4   1.3   28  237-271    31-58  (131)
112 cd04279 ZnMc_MMP_like_1 Zinc-d  32.4      26 0.00057   32.0   1.6   16  375-390   101-116 (156)
113 KOG2199 Signal transducing ada  32.3      22 0.00047   38.3   1.2   25   73-97    161-185 (462)
114 COG0308 PepN Aminopeptidase N   32.1      55  0.0012   38.8   4.6  115  379-498   308-466 (859)
115 PF05572 Peptidase_M43:  Pregna  31.7      27 0.00059   32.6   1.6   20  374-394    65-84  (154)
116 KOG1280 Uncharacterized conser  31.6      33 0.00071   36.3   2.3   16  228-243    73-88  (381)
117 PF06689 zf-C4_ClpX:  ClpX C4-t  31.6      38 0.00082   24.6   2.0   32  236-267     3-34  (41)
118 PRK14559 putative protein seri  31.6      40 0.00088   38.7   3.2   37  164-207     3-39  (645)
119 PF13574 Reprolysin_2:  Metallo  31.5      28  0.0006   32.9   1.7   18  378-395   111-128 (173)
120 cd06461 M2_ACE Peptidase famil  31.5      50  0.0011   36.6   3.8   33  381-414   250-290 (477)
121 cd04327 ZnMc_MMP_like_3 Zinc-d  31.4      31 0.00068   33.1   2.0   16  377-392    91-106 (198)
122 PF08394 Arc_trans_TRASH:  Arch  31.4      23  0.0005   25.5   0.8   22  138-159     1-23  (37)
123 COG4784 Putative Zn-dependent   31.2      66  0.0014   34.3   4.4  107  367-497   108-220 (479)
124 COG2738 Predicted Zn-dependent  30.8      28 0.00061   34.2   1.5   28  370-397    84-111 (226)
125 PLN03208 E3 ubiquitin-protein   30.3      48   0.001   32.4   3.1   30  162-192    18-47  (193)
126 PF10391 DNA_pol_lambd_f:  Fing  30.3      53  0.0011   25.2   2.7   27  466-494     6-32  (52)
127 cd04282 ZnMc_meprin Zinc-depen  30.2      26 0.00056   35.1   1.3   12  379-390   121-132 (230)
128 TIGR03826 YvyF flagellar opero  29.9      26 0.00056   32.4   1.1   36  236-286     5-40  (137)
129 COG2191 Formylmethanofuran deh  29.8      21 0.00047   35.0   0.6   18  176-193   186-203 (206)
130 cd04269 ZnMc_adamalysin_II_lik  29.8      52  0.0011   31.1   3.2   16  375-390   128-143 (194)
131 cd06160 S2P-M50_like_2 Unchara  29.7      50  0.0011   31.7   3.1   22  376-397    39-61  (183)
132 PF01258 zf-dskA_traR:  Prokary  29.7      10 0.00022   26.6  -1.2   28  165-192     6-33  (36)
133 COG2835 Uncharacterized conser  29.4      40 0.00086   26.9   1.9   16  288-303    34-49  (60)
134 PRK00420 hypothetical protein;  29.3      28  0.0006   31.1   1.2   30  237-272    26-55  (112)
135 COG1645 Uncharacterized Zn-fin  28.8      29 0.00063   31.8   1.2   21  165-190    31-51  (131)
136 PF13834 DUF4193:  Domain of un  28.7      18 0.00039   31.6  -0.1   30  234-264    70-99  (99)
137 COG2888 Predicted Zn-ribbon RN  28.7      51  0.0011   26.3   2.4   29  135-172     9-37  (61)
138 cd04283 ZnMc_hatching_enzyme Z  28.3      31 0.00067   33.2   1.4   12  379-390    78-89  (182)
139 KOG3314 Ku70-binding protein [  28.0      35 0.00075   32.6   1.6   20  375-394    88-107 (194)
140 TIGR00181 pepF oligoendopeptid  27.6      30 0.00065   38.8   1.4   17  375-391   375-391 (591)
141 cd04272 ZnMc_salivary_gland_MP  27.6      37  0.0008   33.1   1.9   15  376-390   143-157 (220)
142 PF01400 Astacin:  Astacin (Pep  27.3      36 0.00077   32.7   1.6   13  378-390    79-91  (191)
143 COG4783 Putative Zn-dependent   27.0      36 0.00079   37.5   1.8   18  376-393   128-145 (484)
144 PRK14873 primosome assembly pr  26.7      38 0.00082   39.0   2.0   58  234-310   410-468 (665)
145 PF13583 Reprolysin_4:  Metallo  26.5      34 0.00074   33.3   1.4   15  380-394   139-153 (206)
146 KOG4739 Uncharacterized protei  26.5      43 0.00092   33.7   2.0   34  174-207    15-49  (233)
147 PF06677 Auto_anti-p27:  Sjogre  26.3      44 0.00094   24.6   1.5   21  237-263    20-40  (41)
148 PF14446 Prok-RING_1:  Prokaryo  26.0      70  0.0015   25.0   2.7   12  135-146     5-16  (54)
149 PF08219 TOM13:  Outer membrane  25.9      47   0.001   27.7   1.8   23  375-398    49-71  (77)
150 COG1381 RecO Recombinational D  25.9      64  0.0014   32.4   3.2   31  232-264   152-182 (251)
151 cd06459 M3B_Oligoendopeptidase  25.1      74  0.0016   33.7   3.7   38  376-413   220-260 (427)
152 PF07607 DUF1570:  Protein of u  25.0      80  0.0017   28.8   3.4   33  380-412     3-39  (128)
153 PF12674 Zn_ribbon_2:  Putative  24.9      34 0.00074   28.7   0.9   29  164-192     2-35  (81)
154 PF13582 Reprolysin_3:  Metallo  24.8      37  0.0008   29.4   1.2   12  379-390   108-119 (124)
155 PF01432 Peptidase_M3:  Peptida  24.7 1.5E+02  0.0033   32.0   6.1   18  377-394   241-258 (458)
156 cd06163 S2P-M50_PDZ_RseP-like   23.3      59  0.0013   31.2   2.3   21  376-396     7-28  (182)
157 KOG2932 E3 ubiquitin ligase in  23.2      39 0.00084   35.3   1.1   42  165-206    93-134 (389)
158 PRK14714 DNA polymerase II lar  23.1      90   0.002   38.5   4.2   51  235-291   693-743 (1337)
159 cd04278 ZnMc_MMP Zinc-dependen  22.8      40 0.00087   30.9   1.0   19  374-393   103-121 (157)
160 cd02249 ZZ Zinc finger, ZZ typ  22.7      69  0.0015   23.5   2.1   11  182-192    22-32  (46)
161 PF13203 DUF2201_N:  Putative m  22.6      57  0.0012   33.1   2.2   23  371-393    53-75  (292)
162 PF13248 zf-ribbon_3:  zinc-rib  22.6      53  0.0011   21.4   1.3    9  137-145     4-12  (26)
163 COG2191 Formylmethanofuran deh  22.5      36 0.00077   33.5   0.6   31  235-267   173-203 (206)
164 PF13923 zf-C3HC4_2:  Zinc fing  22.5      60  0.0013   22.7   1.7   37  165-201     1-39  (39)
165 cd04280 ZnMc_astacin_like Zinc  22.4      43 0.00094   31.8   1.2   10  380-389    76-85  (180)
166 TIGR00595 priA primosomal prot  22.1      61  0.0013   36.0   2.5   27  367-393   374-401 (505)
167 KOG1046 Puromycin-sensitive am  21.8 1.7E+02  0.0037   34.9   6.2   39  375-418   321-366 (882)
168 PF09471 Peptidase_M64:  IgA Pe  21.3      50  0.0011   33.7   1.4   19  377-395   215-233 (264)
169 cd06258 Peptidase_M3_like The   21.2 1.5E+02  0.0033   30.8   5.1   37  376-412   152-196 (365)
170 PRK04439 S-adenosylmethionine   21.0      86  0.0019   33.9   3.1   22  380-402   104-125 (399)
171 PF09943 DUF2175:  Uncharacteri  20.8      25 0.00054   30.9  -0.7   28  137-164     4-32  (101)
172 KOG3579 Predicted E3 ubiquitin  20.7      46   0.001   34.4   1.0   29  138-166   271-299 (352)
173 smart00291 ZnF_ZZ Zinc-binding  20.4      86  0.0019   22.9   2.2   11  182-192    26-36  (44)
174 KOG0978 E3 ubiquitin ligase in  20.3      38 0.00081   39.1   0.3   27  183-209   663-692 (698)

No 1  
>PF12315 DUF3633:  Protein of unknown function (DUF3633);  InterPro: IPR022087  This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with PF00412 from PFAM. 
Probab=100.00  E-value=1.1e-85  Score=624.07  Aligned_cols=209  Identities=74%  Similarity=1.172  Sum_probs=198.1

Q ss_pred             hcccccccccccccccHHHHHHHHhccccCCCCCCcccceeecccceeeeeeccccC-CCCeeeeeeccccccccceeEE
Q 010849          287 GMNMKLDQQIPMLLVERQALNEAIVGEKNGYHHMPETRGLCLSEEQTVTSILRRPRI-GGNRLVGMRTQPQKLTRKCEVT  365 (499)
Q Consensus       287 g~~m~~~~~~p~~lv~~~~ln~a~~~e~~g~~~~~~trglclse~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~r~~~v~  365 (499)
                      +|||||+|+|||+|||++|||+|+++||+|+||+|+||||||||||||+||.|+|++ +++++++|.|+|++++|+|+||
T Consensus         1 ~lnmki~q~~PllLVe~~aLN~a~~~Ek~~~~~~~~tRGLclseeq~v~sv~~~p~~~~~~~~~~~~~e~~~~~~~~eV~   80 (212)
T PF12315_consen    1 GLNMKIEQEIPLLLVERQALNEAEEGEKIGHHHMPETRGLCLSEEQTVTSVLRRPRMGPGNQLIDMSTEPQRLTRGCEVT   80 (212)
T ss_pred             CCCCcccCCCCeEEecHHHHHHHHhhccCCCCCCeeeeeeeeeeeEEEEEEEecCCcCCCCccceeeecceeeccceeEE
Confidence            689999999999999999999999999999999999999999999999999999999 5779999999999999999999


Q ss_pred             EEEEEcCCchhHHHHHHHHHHHHHHHHHhCCCCCChhhhhhHHHHHHHHHhhcccCCCCCCCCC--CCCCCCCCCCCCCC
Q 010849          366 AILVLYGLPRLLTGAILAHELMHGWLRLKGYRNLNPEVEEGICQVLSYMWLESEVLPDYRNMPS--TSSASTSSSSSKKG  443 (499)
Q Consensus       366 ~Ilvl~gLPrl~~g~ilAHE~mHa~l~l~g~~~l~~~veEG~Cq~~a~~wl~~~~~~~~~~~~~--~~~~~~~~~~~~~g  443 (499)
                      +|||||||||++||||||||||||||||+||++|+++|||||||||||+||++|++++..+.++  ++++++++++||||
T Consensus        81 ~Ilvl~GLPrll~gsiLAHE~mHa~Lrl~g~~~L~~~vEEGiCqvla~~wL~~~~~~~~~~~~~~s~~~s~~~~~~skkg  160 (212)
T PF12315_consen   81 AILVLYGLPRLLTGSILAHELMHAWLRLNGFPNLSPEVEEGICQVLAYLWLESELASGSGSSSSSSSSSSSSASSSSKKG  160 (212)
T ss_pred             EEEEECCCCHHHHhhHHHHHHHHHHhcccCCCCCChHHHHHHHHHHHHHHHhhhhhcccCCcccccCCCCCCcccccccc
Confidence            9999999999999999999999999999999999999999999999999999999987664442  23345666778999


Q ss_pred             CchHHHHHHHHHHHhhhhcCCCCCchhhHHHHHHHHHHhCHHHHHHHHHhhC
Q 010849          444 GKSEVEKKLGEFFMHQIAHDASPAYGEGFRIANAAVNKYGLRRTLEHIRLTG  495 (499)
Q Consensus       444 ~~~~~e~~l~~~~~~qi~~d~s~vYGdGfR~~~~a~~~~gl~~~l~~i~~~g  495 (499)
                      ++++||+||++||+||||+|+|||||||||+|++||++|||++||+|||+||
T Consensus       161 ~~s~~E~kL~~f~~~qIe~D~SpvYGdGFRaa~~av~~~GL~~tLdhir~tg  212 (212)
T PF12315_consen  161 AKSQFEKKLGEFFKHQIETDTSPVYGDGFRAANEAVEKYGLRRTLDHIRRTG  212 (212)
T ss_pred             cccHHHHHHHHHHHHHhccCCCcccchHHHHHHHHHHHhCHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999999999999999999998


No 2  
>KOG1703 consensus Adaptor protein Enigma and related PDZ-LIM proteins [Signal transduction mechanisms; Cytoskeleton]
Probab=99.95  E-value=9.9e-29  Score=266.23  Aligned_cols=336  Identities=41%  Similarity=0.664  Sum_probs=284.6

Q ss_pred             CCCCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhh-hccccccccCCccCCCCcc
Q 010849          133 RSYKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKE-LTHPKCEVCHQYIPTNGAG  211 (499)
Q Consensus       133 ~~~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~-~f~pkC~~C~~~I~~~~~g  211 (499)
                      ....+|.+|+..|..+..+          ||.|..|..++.+          +...||.. ...+.|.+|...|..+..+
T Consensus       132 ~~~~~~~~~~~~~~~~~~~----------~~~~~~~~~p~~~----------~~~~~~~~~~~~~~~~v~~~~~~~~~~~  191 (479)
T KOG1703|consen  132 PLDSICGGCNSAIEHGRSV----------CFQCKRCSEPLSG----------FPKPSYHESGRSKNEDVEEASSPSSRAG  191 (479)
T ss_pred             cccccccCCCcccccccch----------hhhhcccccccCC----------cccccccccccccccccccccccccccc
Confidence            3457899999999766655          9999999988822          23344444 3677899999999988888


Q ss_pred             eEEeeccCccccccCCCCcCCCCcccCCCCCccccCCceeEecCCccccchhhhhhccCCCCCCchhhhHHHHHhhcccc
Q 010849          212 LIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNTRYYSLEDGRSLCLECMESAIMDTGDCQPLYHAIRDYYEGMNMK  291 (499)
Q Consensus       212 ~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sav~dt~e~qpl~~~i~~f~~g~~m~  291 (499)
                      .+.++.++||.+.||+.|.+..+..|+.|.+.++++..+..+.+++.+|.+|...+++++..+||++..+..++....|+
T Consensus       192 ~~~~~~~~~~~~~~~~~~e~~~tp~~~~~~r~e~~~~~~~~l~~~~~~~~~~~~~~~~~~p~~~p~~~~~~~~~~~~~~~  271 (479)
T KOG1703|consen  192 LILSRSHPFWKQKYCPSHENDGTPKCCSCERLEPLDTRYVELADGRALCLECMGSASMDSPECQPLVSAPRPASEGLHMK  271 (479)
T ss_pred             ccccccchhhhhcccccccCCCCCCcccccccccccccceecccchhhhhhccCCcccCCCccCcceecccccccccccc
Confidence            89999999999999999999999999999998878999999999999999999999999999999999999999999999


Q ss_pred             cccccccccccHHHHHHHHhccccCCCCCCcccceeecccceeeeeeccccCCCCeeeeeeccccccccceeEEEEEEEc
Q 010849          292 LDQQIPMLLVERQALNEAIVGEKNGYHHMPETRGLCLSEEQTVTSILRRPRIGGNRLVGMRTQPQKLTRKCEVTAILVLY  371 (499)
Q Consensus       292 ~~~~~p~~lv~~~~ln~a~~~e~~g~~~~~~trglclse~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~v~~Ilvl~  371 (499)
                      +.+..+++++++++++.+.+.++...++. .++++|++++++|+++        ..++++.++..+....|+|.+|++++
T Consensus       272 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~p~c~~c~~~i~~~--------~~i~~~~~~~h~~~~~c~~~~~~~~~  342 (479)
T KOG1703|consen  272 VEKELPLLLVESEALKKLREEEKPAEYHN-VTRPLCLSCNQKIRSV--------KVIVALGKEWHPEHFSCEVCAIVILD  342 (479)
T ss_pred             cccccchhhcccccccccccccccccccc-cccccccccccCcccc--------eeEeeccccccccceeeccccccccC
Confidence            99999999999999999988877665443 8999999999999775        34668888888888899999999999


Q ss_pred             CCchhHHHHHHHHHHHHHHHHHhCCCCCChhhhhhHHHHHHHHHhhcccCCCCCCCC-CCCCC------CCCCCCCCCCC
Q 010849          372 GLPRLLTGAILAHELMHGWLRLKGYRNLNPEVEEGICQVLSYMWLESEVLPDYRNMP-STSSA------STSSSSSKKGG  444 (499)
Q Consensus       372 gLPrl~~g~ilAHE~mHa~l~l~g~~~l~~~veEG~Cq~~a~~wl~~~~~~~~~~~~-~~~~~------~~~~~~~~~g~  444 (499)
                      |+|+...|.|++||+||+|++.++++.+.+.+||+||++ +.+|+...-.-..-... ...+.      .......+++.
T Consensus       343 ~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~~v~a~-~~~wH~~cf~C~~C~~~~~~~~~~~~~~~pyce~~~~~~~  421 (479)
T KOG1703|consen  343 GGPRELDGKILCHECFHAPFRPNCKRCLLPILEEGVCAL-GRLWHPECFVCADCGKPLKNSSFFESDGEPYCEDHYKKLF  421 (479)
T ss_pred             CCccccCCCccHHHHHHHhhCccccccCCchHHhHhhhc-cCeechhceeeecccCCCCCCcccccCCccchhhhHhhhc
Confidence            999999999999999999999999999999999999999 99999998654311111 11111      11112223433


Q ss_pred             --chHHHHHHHHHHHhhhhcCCCCCchhhHHHHHHHHHHh--CHHHHHHHHHhhCCCC
Q 010849          445 --KSEVEKKLGEFFMHQIAHDASPAYGEGFRIANAAVNKY--GLRRTLEHIRLTGNFP  498 (499)
Q Consensus       445 --~~~~e~~l~~~~~~qi~~d~s~vYGdGfR~~~~a~~~~--gl~~~l~~i~~~g~~p  498 (499)
                        +..++++.++|+.++|+.|.+++||+|||.++.+++..  ++..+++++.....|+
T Consensus       422 ~~~~~~~~~p~~~~~~~ie~~~~~~h~~~F~c~~c~~~l~~~~~~~~~~~p~c~~~~~  479 (479)
T KOG1703|consen  422 TTKCDYCKKPVEFGSRQIEADGSPFHGDCFRCANCMKKLTKKTFFETLDKPLCQKHFP  479 (479)
T ss_pred             cccchhccchhHhhhhHhhccCccccccceehhhhhccccCCceeecCCccccccCCC
Confidence              77889999999999999999999999999999998777  7999998888776654


No 3  
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms]
Probab=99.84  E-value=2.8e-22  Score=206.45  Aligned_cols=157  Identities=24%  Similarity=0.432  Sum_probs=131.8

Q ss_pred             CCCccccc--chHHHHHHhh--cccCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCC
Q 010849           97 NGQRWRSN--TDEDYAWALQ--DSQLNPSFPPYDPSHYYPRSYKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPI  172 (499)
Q Consensus        97 ~~~~wh~e--~ce~c~r~Lq--~~l~~~~~~pyC~~~y~~~~~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L  172 (499)
                      .++.+|.+  +|.+|.+.|.  .+++.+. +|||+.||.. ...+|..|++.|. .++|.|+|+.||+.||+|..|++.|
T Consensus       294 m~~~fHv~CFtC~~C~r~L~Gq~FY~v~~-k~~CE~cyq~-tlekC~~Cg~~I~-d~iLrA~GkayHp~CF~Cv~C~r~l  370 (468)
T KOG1701|consen  294 MDQLFHVQCFTCRTCRRQLAGQSFYQVDG-KPYCEGCYQD-TLEKCNKCGEPIM-DRILRALGKAYHPGCFTCVVCARCL  370 (468)
T ss_pred             hhhhhcccceehHhhhhhhccccccccCC-cccchHHHHH-HHHHHhhhhhHHH-HHHHHhcccccCCCceEEEEecccc
Confidence            34468988  9999999994  6667776 9999999854 4678999999996 6899999999999999999999999


Q ss_pred             CCCceEee-CCcccchhhhhhhccccccccCCccCCCC----cceEEeeccCccccccCCCCcCCCCcccCCCCCcccc-
Q 010849          173 TEHEFSLS-GKDPYHKSCFKELTHPKCEVCHQYIPTNG----AGLIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESW-  246 (499)
Q Consensus       173 ~~~~F~~~-dg~~YC~~CY~~~f~pkC~~C~~~I~~~~----~g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~-  246 (499)
                      ++..|.+. ++++||..||+++|+|+|++|+++|...+    .-.|....+.|          |.+|++|..|+.++++ 
T Consensus       371 dgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~~etvRvvamdr~f----------Hv~CY~CEDCg~~LS~e  440 (468)
T KOG1701|consen  371 DGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGKDETVRVVAMDRDF----------HVNCYKCEDCGLLLSSE  440 (468)
T ss_pred             CCccccccCCCceeeehhhhhhcCcchhhccCCccCCCCCcceEEEEEccccc----------cccceehhhcCcccccc
Confidence            99988875 88999999999999999999999998863    33455555443          9999999999998873 


Q ss_pred             --CCceeEecCCccccchhhhhh
Q 010849          247 --NTRYYSLEDGRSLCLECMESA  267 (499)
Q Consensus       247 --g~~~~~l~dGr~~C~~C~~sa  267 (499)
                        +...|.++ |.++|+.|+...
T Consensus       441 ~e~qgCyPld-~HllCk~Ch~~R  462 (468)
T KOG1701|consen  441 EEGQGCYPLD-GHLLCKTCHLKR  462 (468)
T ss_pred             CCCCcceecc-Cceeechhhhhh
Confidence              23456665 799999998554


No 4  
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription]
Probab=99.74  E-value=4.6e-20  Score=181.65  Aligned_cols=125  Identities=25%  Similarity=0.513  Sum_probs=109.8

Q ss_pred             CCCCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhhhccccccccCCccCCCCcce
Q 010849          133 RSYKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKELTHPKCEVCHQYIPTNGAGL  212 (499)
Q Consensus       133 ~~~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~pkC~~C~~~I~~~~~g~  212 (499)
                      .-.++|++|++.|.+.-++.+++++||..|++|+.|+.+|.+ .+|.+++.+||+.+|.++|+.||..|...|++..   
T Consensus        31 ~eip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~d-rCFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtq---  106 (383)
T KOG4577|consen   31 VEIPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLAD-RCFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQ---  106 (383)
T ss_pred             cccccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHHH-HHhhcCCceeehHHHHHHhCCcchhhcCCCChHH---
Confidence            356899999999986667889999999999999999999988 5668899999999999999999999999999852   


Q ss_pred             EEeeccCccccccCCCCcCCCCcccCCCCCccccCCceeEecCCccccchhhhhhcc
Q 010849          213 IEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNTRYYSLEDGRSLCLECMESAIM  269 (499)
Q Consensus       213 I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sav~  269 (499)
                      +.-+++.|   .|     |..||.|..|+|.+..|++||.+.|++++|+..|+++-.
T Consensus       107 VVRkAqd~---VY-----Hl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~  155 (383)
T KOG4577|consen  107 VVRKAQDF---VY-----HLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQ  155 (383)
T ss_pred             HHHHhhcc---ee-----ehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHh
Confidence            22233333   34     999999999999999999999999999999999999865


No 5  
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton]
Probab=99.69  E-value=1.4e-18  Score=168.81  Aligned_cols=162  Identities=23%  Similarity=0.499  Sum_probs=134.2

Q ss_pred             chhhhcCcCCCccccc--chHHHHHHhhcccCCCC-CCCCCCCCCCCCCCCCCCCCCCccCCCceEeecCccccCCCccc
Q 010849           89 LAEDLKRPNGQRWRSN--TDEDYAWALQDSQLNPS-FPPYDPSHYYPRSYKVCGGCNCDIGYGNYLGCMGTYFHPNCFRC  165 (499)
Q Consensus        89 L~Ee~kk~~~~~wh~e--~ce~c~r~Lq~~l~~~~-~~pyC~~~y~~~~~~~C~~C~k~I~~g~~l~algk~wHp~CF~C  165 (499)
                      ++|.-...++..||+.  .|.||-+++++.+..+- ++.||+.|+...++|-|+.|++.|. |++|.+++.+|||.||+|
T Consensus        24 ~~e~~vns~ge~wH~~CFvCAQCf~pf~~g~~~efEgRkYCEhDF~~LfaPcC~kC~EFii-GrVikamnnSwHp~CF~C  102 (332)
T KOG2272|consen   24 PAEKIVNSNGELWHEQCFVCAQCFRPFPDGIFYEFEGRKYCEHDFHVLFAPCCGKCGEFII-GRVIKAMNNSWHPACFRC  102 (332)
T ss_pred             chhhhhccCchhhHHHHHHHHHhcCcCCCceeEEecCcccccccchhhhchhhcccccchh-hHHHHhhccccCcccchh
Confidence            4555566678899988  89999999988765432 4899999999999999999999995 999999999999999999


Q ss_pred             CCCCCCCCCCceEeeCCcccchhhhhhhc-----cccccccCCccCCCCcceEEeeccCccccccCCCCcCCCCcccCCC
Q 010849          166 RSCGYPITEHEFSLSGKDPYHKSCFKELT-----HPKCEVCHQYIPTNGAGLIEYRCHPFWAQKYCPSHEHDHTSRCCSC  240 (499)
Q Consensus       166 ~~C~~~L~~~~F~~~dg~~YC~~CY~~~f-----~pkC~~C~~~I~~~~~g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C  240 (499)
                      ..|++.|.+..|+-..|..+|..|..+.-     .-.|..|+..|...   .+.++..|     |     |+..|+|..|
T Consensus       103 d~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~~---~l~fr~d~-----y-----H~yHFkCt~C  169 (332)
T KOG2272|consen  103 DLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDEQ---PLTFRGDP-----Y-----HPYHFKCTTC  169 (332)
T ss_pred             HHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhcccc---cccccCCC-----C-----Cccceecccc
Confidence            99999999999999999999999987732     23599999998773   57777655     3     7777999999


Q ss_pred             CCccccCCceeEecCCccccchhhhhh
Q 010849          241 ERLESWNTRYYSLEDGRSLCLECMESA  267 (499)
Q Consensus       241 ~r~~~~g~~~~~l~dGr~~C~~C~~sa  267 (499)
                      ++.+..+.+  .++ |.+||+.|++++
T Consensus       170 ~keL~sdaR--evk-~eLyClrChD~m  193 (332)
T KOG2272|consen  170 GKELTSDAR--EVK-GELYCLRCHDKM  193 (332)
T ss_pred             cccccchhh--hhc-cceecccccccc
Confidence            997654443  334 699999998765


No 6  
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton]
Probab=99.69  E-value=2.7e-18  Score=166.72  Aligned_cols=148  Identities=16%  Similarity=0.363  Sum_probs=124.7

Q ss_pred             chHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcc
Q 010849          105 TDEDYAWALQDSQLNPSFPPYDPSHYYPRSYKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDP  184 (499)
Q Consensus       105 ~ce~c~r~Lq~~l~~~~~~pyC~~~y~~~~~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~  184 (499)
                      .|..|.+.|......-.+..||..|+...+.++|+.|.++|. ++++.++|+.||.+.|+|+.|.+|+-+.+.+.+.|.+
T Consensus       165 kCt~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIe-ervi~amgKhWHveHFvCa~CekPFlGHrHYEkkGla  243 (332)
T KOG2272|consen  165 KCTTCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIE-ERVIFAMGKHWHVEHFVCAKCEKPFLGHRHYEKKGLA  243 (332)
T ss_pred             ecccccccccchhhhhccceeccccccccCCcccccccCchH-HHHHHHhccccchhheeehhcCCcccchhhhhhcCch
Confidence            666666666543322223669999999999999999999995 8999999999999999999999999999999999999


Q ss_pred             cchhhhhhhccccccccCCccCCCCcceEEeeccCccccccCCCCcCCCCcccCCCCCccccCCceeEecCCccccchhh
Q 010849          185 YHKSCFKELTHPKCEVCHQYIPTNGAGLIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNTRYYSLEDGRSLCLECM  264 (499)
Q Consensus       185 YC~~CY~~~f~pkC~~C~~~I~~~~~g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~  264 (499)
                      ||+.+|.++|+..|..|+..|.+.   ++.+.     ++.|     -+.||.|+.|.+.+..-++++.++ -.|+|+.||
T Consensus       244 YCe~h~~qLfG~~CF~C~~~i~G~---vv~al-----~Kaw-----Cv~cf~Cs~Cdkkl~~K~Kf~E~D-mkP~CKkCy  309 (332)
T KOG2272|consen  244 YCETHYHQLFGNLCFICNRVIGGD---VVSAL-----NKAW-----CVECFSCSTCDKKLTQKNKFYEFD-MKPVCKKCY  309 (332)
T ss_pred             hHHHHHHHHhhhhheecCCccCcc---HHHHh-----hhhh-----ccccccccccccccccccceeeec-cchHHHHHH
Confidence            999999999999999999999984   34443     3344     566799999999998888877766 599999999


Q ss_pred             hhh
Q 010849          265 ESA  267 (499)
Q Consensus       265 ~sa  267 (499)
                      +..
T Consensus       310 ~rf  312 (332)
T KOG2272|consen  310 DRF  312 (332)
T ss_pred             hhc
Confidence            755


No 7  
>KOG1703 consensus Adaptor protein Enigma and related PDZ-LIM proteins [Signal transduction mechanisms; Cytoskeleton]
Probab=99.68  E-value=4.1e-18  Score=184.11  Aligned_cols=154  Identities=23%  Similarity=0.453  Sum_probs=131.1

Q ss_pred             CCCccccc--chHHHHHHhhcccC-CCCCCCCCCCCCCCCCCCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCC
Q 010849           97 NGQRWRSN--TDEDYAWALQDSQL-NPSFPPYDPSHYYPRSYKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPIT  173 (499)
Q Consensus        97 ~~~~wh~e--~ce~c~r~Lq~~l~-~~~~~pyC~~~y~~~~~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~  173 (499)
                      .+..||.+  .|+.|+..+..... ...+.+||..|+.+...+.|.+|+++|. ++.|.+++..||++||+|..|++++.
T Consensus       322 ~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~-~~~v~a~~~~wH~~cf~C~~C~~~~~  400 (479)
T KOG1703|consen  322 LGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPIL-EEGVCALGRLWHPECFVCADCGKPLK  400 (479)
T ss_pred             ccccccccceeeccccccccCCCccccCCCccHHHHHHHhhCccccccCCchH-HhHhhhccCeechhceeeecccCCCC
Confidence            45589988  89999988876544 2335889999999999999999999995 89999999999999999999999999


Q ss_pred             CCceEeeCCcccchhhhhhhccccccccCCccCCCCcceEEeeccCccccccCCCCcCCCCcccCCCCCccccCCceeEe
Q 010849          174 EHEFSLSGKDPYHKSCFKELTHPKCEVCHQYIPTNGAGLIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNTRYYSL  253 (499)
Q Consensus       174 ~~~F~~~dg~~YC~~CY~~~f~pkC~~C~~~I~~~~~g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~~~~~l  253 (499)
                      ...|+..++.+||..||++++.++|..|.++|..-. -.|+....+          ||..||+|..|.+  .+.++.|..
T Consensus       401 ~~~~~~~~~~pyce~~~~~~~~~~~~~~~~p~~~~~-~~ie~~~~~----------~h~~~F~c~~c~~--~l~~~~~~~  467 (479)
T KOG1703|consen  401 NSSFFESDGEPYCEDHYKKLFTTKCDYCKKPVEFGS-RQIEADGSP----------FHGDCFRCANCMK--KLTKKTFFE  467 (479)
T ss_pred             CCcccccCCccchhhhHhhhccccchhccchhHhhh-hHhhccCcc----------ccccceehhhhhc--cccCCceee
Confidence            999999999999999999999999999999987432 234554443          2999999999999  456667777


Q ss_pred             cCCccccchhh
Q 010849          254 EDGRSLCLECM  264 (499)
Q Consensus       254 ~dGr~~C~~C~  264 (499)
                      ..++++|..|.
T Consensus       468 ~~~~p~c~~~~  478 (479)
T KOG1703|consen  468 TLDKPLCQKHF  478 (479)
T ss_pred             cCCccccccCC
Confidence            77899999985


No 8  
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms]
Probab=99.66  E-value=3.7e-18  Score=176.17  Aligned_cols=123  Identities=21%  Similarity=0.545  Sum_probs=102.6

Q ss_pred             CCCCCCCCCCCCCccC-CCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhhhccccccccCCccCCCC
Q 010849          131 YPRSYKVCGGCNCDIG-YGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKELTHPKCEVCHQYIPTNG  209 (499)
Q Consensus       131 ~~~~~~~C~~C~k~I~-~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~pkC~~C~~~I~~~~  209 (499)
                      ...++.+|.+|+|.|. ++..+.||++.||..||+|..|++.|.+..||..++++||+.||.+ ...||.+|++.|... 
T Consensus       270 ~~~~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~-tlekC~~Cg~~I~d~-  347 (468)
T KOG1701|consen  270 VEDYFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQD-TLEKCNKCGEPIMDR-  347 (468)
T ss_pred             hhhhhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHH-HHHHHhhhhhHHHHH-
Confidence            3345569999999994 3456899999999999999999999999999999999999999988 788999999999973 


Q ss_pred             cceEEeeccCccccccCCCCcCCCCcccCCCCCccccCC-ceeEecCCccccchhhhhhcc
Q 010849          210 AGLIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNT-RYYSLEDGRSLCLECMESAIM  269 (499)
Q Consensus       210 ~g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~-~~~~l~dGr~~C~~C~~sav~  269 (499)
                        ++.+.     |+.|     |++||+|.+|.+  .+++ .|....++++||..||.....
T Consensus       348 --iLrA~-----Gkay-----Hp~CF~Cv~C~r--~ldgipFtvd~~n~v~Cv~dfh~kfA  394 (468)
T KOG1701|consen  348 --ILRAL-----GKAY-----HPGCFTCVVCAR--CLDGIPFTVDSQNNVYCVPDFHKKFA  394 (468)
T ss_pred             --HHHhc-----cccc-----CCCceEEEEecc--ccCCccccccCCCceeeehhhhhhcC
Confidence              44443     4555     999999999999  4455 555556889999999866544


No 9  
>KOG1044 consensus Actin-binding LIM Zn-finger protein Limatin involved in axon guidance [Signal transduction mechanisms; Cytoskeleton]
Probab=99.54  E-value=1.9e-15  Score=160.82  Aligned_cols=123  Identities=21%  Similarity=0.506  Sum_probs=106.7

Q ss_pred             CCCCCCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhhhccccccccCCccCCCCc
Q 010849          131 YPRSYKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKELTHPKCEVCHQYIPTNGA  210 (499)
Q Consensus       131 ~~~~~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~pkC~~C~~~I~~~~~  210 (499)
                      ...+...|++|++.|..|+.+.++++.||..||+|..|+..|.+ ++..+++.|||..||.+.|+.+|..|.++|.+.  
T Consensus       129 ~~~~ps~cagc~~~lk~gq~llald~qwhv~cfkc~~c~~vL~g-ey~skdg~pyce~dy~~~fgvkc~~c~~fisgk--  205 (670)
T KOG1044|consen  129 ESYGPSTCAGCGEELKNGQALLALDKQWHVSCFKCKSCSAVLNG-EYMSKDGVPYCEKDYQAKFGVKCEECEKFISGK--  205 (670)
T ss_pred             cccCCccccchhhhhhccceeeeeccceeeeeeehhhhcccccc-eeeccCCCcchhhhhhhhcCeehHHhhhhhhhh--
Confidence            33467889999999999999999999999999999999999987 899999999999999999999999999999984  


Q ss_pred             ceEEeeccCccccccCCCCcCCCCcccCCCCCccccCCceeEecCCccccchhhhhhc
Q 010849          211 GLIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNTRYYSLEDGRSLCLECMESAI  268 (499)
Q Consensus       211 g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sav  268 (499)
                       ++++..          .|||+.|-+|..|+.+|..|.+-|. ....++.+.|-....
T Consensus       206 -vLqag~----------kh~HPtCARCsRCgqmF~eGEEMYl-QGs~iWHP~C~qa~~  251 (670)
T KOG1044|consen  206 -VLQAGD----------KHFHPTCARCSRCGQMFGEGEEMYL-QGSEIWHPDCKQATK  251 (670)
T ss_pred             -hhhccC----------cccCcchhhhhhhccccccchheee-ccccccCCccccccc
Confidence             344432          2679999999999999998877664 445899999975543


No 10 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.24  E-value=8.7e-12  Score=96.25  Aligned_cols=57  Identities=32%  Similarity=0.865  Sum_probs=52.5

Q ss_pred             CCCCCCccCCCceE-eecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhhhc
Q 010849          138 CGGCNCDIGYGNYL-GCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKELT  194 (499)
Q Consensus       138 C~~C~k~I~~g~~l-~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f  194 (499)
                      |.+|+++|..+..+ .++|+.||++||+|..|+++|.+..|+..++++||..||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            88999999766655 7999999999999999999999888999999999999999876


No 11 
>KOG1044 consensus Actin-binding LIM Zn-finger protein Limatin involved in axon guidance [Signal transduction mechanisms; Cytoskeleton]
Probab=99.06  E-value=1.1e-10  Score=124.97  Aligned_cols=111  Identities=21%  Similarity=0.513  Sum_probs=91.9

Q ss_pred             CCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhhhccccccccCCccCCCCcceEE
Q 010849          135 YKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKELTHPKCEVCHQYIPTNGAGLIE  214 (499)
Q Consensus       135 ~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~pkC~~C~~~I~~~~~g~I~  214 (499)
                      ...|..|.+... |+++.+.++.||..||+|..|+..|....||.+++.        +++++  ..|..+|.+.   .+.
T Consensus        16 ~i~c~~c~~kc~-gevlrv~d~~fhi~cf~c~~cg~~la~~gff~k~~~--------~~ygt--~~c~~~~~ge---vvs   81 (670)
T KOG1044|consen   16 GIKCDKCRKKCS-GEVLRVNDNHFHINCFQCKKCGRNLAEGGFFTKPEN--------RLYGT--DDCRAFVEGE---VVS   81 (670)
T ss_pred             ceehhhhCCccc-cceeEeeccccceeeeeccccCCCcccccceecccc--------eeecc--cchhhhccce---eEe
Confidence            467999999995 999999999999999999999999999999988765        44555  7788888874   354


Q ss_pred             eeccCccccccCCCCcCCCCcccCCCCCccccCCceeEecCCccccchhhhhhccC
Q 010849          215 YRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNTRYYSLEDGRSLCLECMESAIMD  270 (499)
Q Consensus       215 ~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sav~d  270 (499)
                      ..     |++|     |++||.|+.|+.+++.|++ +.+.....+|..|...+-..
T Consensus        82 a~-----gkty-----h~~cf~cs~ck~pf~~g~~-vt~~gk~~~c~~c~~~~~~~  126 (670)
T KOG1044|consen   82 TL-----GKTY-----HPKCFSCSTCKSPFKSGDK-VTFSGKECLCQTCSQPMPVS  126 (670)
T ss_pred             cc-----ccee-----ccccceecccCCCCCCCCe-eeecchhhhhhhhcCcccCC
Confidence            44     5566     9999999999999998887 56666789999997666543


No 12 
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription]
Probab=98.60  E-value=4.1e-09  Score=104.88  Aligned_cols=103  Identities=19%  Similarity=0.368  Sum_probs=86.9

Q ss_pred             CCCccccc--chHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCceEe-ecCccccCCCcccCCCCCCCC
Q 010849           97 NGQRWRSN--TDEDYAWALQDSQLNPSFPPYDPSHYYPRSYKVCGGCNCDIGYGNYLG-CMGTYFHPNCFRCRSCGYPIT  173 (499)
Q Consensus        97 ~~~~wh~e--~ce~c~r~Lq~~l~~~~~~pyC~~~y~~~~~~~C~~C~k~I~~g~~l~-algk~wHp~CF~C~~C~~~L~  173 (499)
                      .++.||..  .|..|.-.|.+.-+...+.-||..+|+..+.-+|..|++.|.+.++|. +.+..||..||.|..|++.|.
T Consensus        52 l~R~wHs~CLkCs~C~~qL~drCFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~  131 (383)
T KOG4577|consen   52 LDRHWHSSCLKCSDCHDQLADRCFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQLA  131 (383)
T ss_pred             HhhhhhhhhcchhhhhhHHHHHHhhcCCceeehHHHHHHhCCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcccc
Confidence            35689988  899999999877666555889999999999999999999998777765 889999999999999999998


Q ss_pred             -CCceEe-eCCcccchhhhhhhcccccc
Q 010849          174 -EHEFSL-SGKDPYHKSCFKELTHPKCE  199 (499)
Q Consensus       174 -~~~F~~-~dg~~YC~~CY~~~f~pkC~  199 (499)
                       +.+|+. .|.++.|+.+|...-..-|.
T Consensus       132 TGdEFYLmeD~rLvCK~DYE~Ak~k~~~  159 (383)
T KOG4577|consen  132 TGDEFYLMEDARLVCKDDYETAKQKHCN  159 (383)
T ss_pred             cCCeeEEeccceeehhhhHHHHHhcccc
Confidence             557775 48899999999885444443


No 13 
>KOG1700 consensus Regulatory protein MLP and related LIM proteins [Signal transduction mechanisms; Cytoskeleton]
Probab=98.56  E-value=1.7e-08  Score=97.91  Aligned_cols=121  Identities=22%  Similarity=0.461  Sum_probs=91.0

Q ss_pred             CCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhhhcccc-----------------
Q 010849          135 YKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKELTHPK-----------------  197 (499)
Q Consensus       135 ~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~pk-----------------  197 (499)
                      ...|.+|++.+..-+.+...|..||+.||.|..|.+.|....+..+++.+||+.||..+++|+                 
T Consensus         7 ~~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~~~~   86 (200)
T KOG1700|consen    7 TDKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGLGKD   86 (200)
T ss_pred             cchhhhccCcchHHHHHhccCcchhhhHHhccccccccccccccccccccccccchHhhhCcccccccccccccCCCCcc
Confidence            458999999997666677889999999999999999999888999999999999887766554                 


Q ss_pred             ------------------------ccccCCccCCCCcceEEeeccCccccccCCCCcCCCCcccCCCCCccccCCceeEe
Q 010849          198 ------------------------CEVCHQYIPTNGAGLIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNTRYYSL  253 (499)
Q Consensus       198 ------------------------C~~C~~~I~~~~~g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~~~~~l  253 (499)
                                              |..|.+++.+.+. .+ ..     +..     ||..||+|..|+..+.  ..-+..
T Consensus        87 ~~~~~~~~~~~~~~~~~~~g~~~~c~~c~k~vy~~Ek-~~-~~-----~~~-----~hk~cfrc~~~~~~ls--~~~~~~  152 (200)
T KOG1700|consen   87 GKSLNESKPNQSAKFQVFAGEKEKCARCQKTVYPLEK-VT-GN-----GLE-----FHKSCFRCTHCGKKLS--PKNYAA  152 (200)
T ss_pred             cccccccccccchhHHhhhccccccccccceeeehHH-Hh-hh-----hhh-----hhhhheeecccccccC--Ccchhh
Confidence                                    6666665554321 11 11     111     3999999999999654  444666


Q ss_pred             cCCccccchhhhhhcc
Q 010849          254 EDGRSLCLECMESAIM  269 (499)
Q Consensus       254 ~dGr~~C~~C~~sav~  269 (499)
                      .+|.++|...+-....
T Consensus       153 ~~g~l~~~~~~~~~~~  168 (200)
T KOG1700|consen  153 LEGVLYCKHHFAQLFK  168 (200)
T ss_pred             cCCccccchhhheeec
Confidence            6778888777655544


No 14 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=98.33  E-value=5.3e-07  Score=69.42  Aligned_cols=57  Identities=19%  Similarity=0.415  Sum_probs=41.8

Q ss_pred             ccccCCccCCCCcceEEeeccCccccccCCCCcCCCCcccCCCCCccccCCceeEecCCccccchhhhhh
Q 010849          198 CEVCHQYIPTNGAGLIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNTRYYSLEDGRSLCLECMESA  267 (499)
Q Consensus       198 C~~C~~~I~~~~~g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sa  267 (499)
                      |..|+++|.+.. ..+.+..     +.     ||+.||+|..|++.+.  +..+...||++||..||...
T Consensus         1 C~~C~~~I~~~~-~~~~~~~-----~~-----~H~~Cf~C~~C~~~l~--~~~~~~~~~~~~C~~c~~~~   57 (58)
T PF00412_consen    1 CARCGKPIYGTE-IVIKAMG-----KF-----WHPECFKCSKCGKPLN--DGDFYEKDGKPYCKDCYQKR   57 (58)
T ss_dssp             BTTTSSBESSSS-EEEEETT-----EE-----EETTTSBETTTTCBTT--TSSEEEETTEEEEHHHHHHH
T ss_pred             CCCCCCCccCcE-EEEEeCC-----cE-----EEccccccCCCCCccC--CCeeEeECCEEECHHHHhhh
Confidence            789999999764 1223432     22     3999999999999654  44366777899999999754


No 15 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.20  E-value=1.2e-06  Score=61.51  Aligned_cols=37  Identities=41%  Similarity=1.032  Sum_probs=33.4

Q ss_pred             CCCCCCCccCCC-ceEeecCccccCCCcccCCCCCCCC
Q 010849          137 VCGGCNCDIGYG-NYLGCMGTYFHPNCFRCRSCGYPIT  173 (499)
Q Consensus       137 ~C~~C~k~I~~g-~~l~algk~wHp~CF~C~~C~~~L~  173 (499)
                      .|.+|+++|..+ ..+.+.++.||+.||+|..|+.+|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            489999999765 6788999999999999999999985


No 16 
>PF13485 Peptidase_MA_2:  Peptidase MA superfamily
Probab=97.32  E-value=0.00049  Score=59.53  Aligned_cols=108  Identities=24%  Similarity=0.258  Sum_probs=67.5

Q ss_pred             cCCchhHHHHHHHHHHHHHHHHHhC--CCCCChhhhhhHHHHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCCCCCchHH
Q 010849          371 YGLPRLLTGAILAHELMHGWLRLKG--YRNLNPEVEEGICQVLSYMWLESEVLPDYRNMPSTSSASTSSSSSKKGGKSEV  448 (499)
Q Consensus       371 ~gLPrl~~g~ilAHE~mHa~l~l~g--~~~l~~~veEG~Cq~~a~~wl~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~  448 (499)
                      .+-+.-.+..+|+||+.|+|+.-..  ...++..+.||++++++..+-. ...........            .+....+
T Consensus        18 ~~~~~~~~~~~l~HE~~H~~~~~~~~~~~~~~~W~~EG~A~y~~~~~~~-~~~~~~~~~~~------------~~~~~~~   84 (128)
T PF13485_consen   18 QGSDEDWLDRVLAHELAHQWFGNYFGGDDNAPRWFNEGLAEYVEGRIED-EFDEDLKQAIE------------SGSLPPL   84 (128)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHcCCCccCchHHHHHHHHHHhcCccc-hhHHHHHHHHH------------cCCCCCh
Confidence            3455555559999999999998873  2478999999999999954211 00000000000            0000111


Q ss_pred             HHHHHHHHHhhhhcCCCCCchhhHHHHHHHHHHhCHHHHHHHHHh
Q 010849          449 EKKLGEFFMHQIAHDASPAYGEGFRIANAAVNKYGLRRTLEHIRL  493 (499)
Q Consensus       449 e~~l~~~~~~qi~~d~s~vYGdGfR~~~~a~~~~gl~~~l~~i~~  493 (499)
                      + .|...+.. ...+.+..|.-|+-.+....+++|...+.+-|+.
T Consensus        85 ~-~l~~~~~~-~~~~~~~~Y~~~~~~~~~L~~~~G~~~~~~~l~~  127 (128)
T PF13485_consen   85 E-PLNSSFDF-SWEDDSLAYYQGYLFVRFLEEKYGREKFKAFLRE  127 (128)
T ss_pred             H-HHhccccc-cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            1 22222211 5667777999999999999999998777776664


No 17 
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only]
Probab=96.82  E-value=0.00017  Score=70.14  Aligned_cols=115  Identities=20%  Similarity=0.328  Sum_probs=88.8

Q ss_pred             CCCCccCCCceEeecCccccCCCcccCCCCCCCC--CCceEeeCCcccchhhhhh--hccccccccCCccCCCCcceEEe
Q 010849          140 GCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPIT--EHEFSLSGKDPYHKSCFKE--LTHPKCEVCHQYIPTNGAGLIEY  215 (499)
Q Consensus       140 ~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~--~~~F~~~dg~~YC~~CY~~--~f~pkC~~C~~~I~~~~~g~I~~  215 (499)
                      +|+..|.+...+...+..||..|..|..|..++.  ...|.. ++..||..+|..  .+..+|..|...|...+     .
T Consensus         1 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~~d~~~~~~~~~rr~rt~~~~~ql~-----~   74 (235)
T KOG0490|consen    1 GCGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSK-DGSIYCKRDYQREFKFSKRCARCKFTISQLD-----E   74 (235)
T ss_pred             CCCccccchHHhhcccHHHHHHHHhhhhhcchhccCCCcccC-CCcccccccchhhhhccccccCCCCCcCHHH-----H
Confidence            4777886555677779999999999999999998  545656 999999999998  88999999999986532     1


Q ss_pred             eccCccccccCCCCcCCCCcccCCCCCccccCCceeEecCCccccchhhhhh
Q 010849          216 RCHPFWAQKYCPSHEHDHTSRCCSCERLESWNTRYYSLEDGRSLCLECMESA  267 (499)
Q Consensus       216 ~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sa  267 (499)
                      +...|  ++     -|.-||.|..|.+....++++.+-...+..|...+...
T Consensus        75 ler~f--~~-----~h~Pd~~~r~~la~~~~~~e~rVqvwFqnrrak~r~~~  119 (235)
T KOG0490|consen   75 LERAF--EK-----VHLPCFACRECLALLLTGDEFRVQVWFQNRRAKDRKEE  119 (235)
T ss_pred             HHHhh--cC-----CCcCccchHHHHhhcCCCCeeeeehhhhhhcHhhhhhh
Confidence            11122  11     18899999999998777777666666688888877554


No 18 
>KOG1700 consensus Regulatory protein MLP and related LIM proteins [Signal transduction mechanisms; Cytoskeleton]
Probab=96.59  E-value=0.00055  Score=66.58  Aligned_cols=62  Identities=24%  Similarity=0.487  Sum_probs=54.5

Q ss_pred             CCCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhhhcc
Q 010849          134 SYKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKELTH  195 (499)
Q Consensus       134 ~~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~  195 (499)
                      ....|.+|.+.+.+-+-+...+..||..||+|..|+..|+...+....+.+||...+.+++.
T Consensus       107 ~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~~~~~~  168 (200)
T KOG1700|consen  107 EKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHFAQLFK  168 (200)
T ss_pred             cccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchhhcCCccccchhhheeec
Confidence            45689999999988888889999999999999999999999999999999999877666443


No 19 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=96.52  E-value=0.0022  Score=44.69  Aligned_cols=37  Identities=19%  Similarity=0.318  Sum_probs=26.1

Q ss_pred             cccccCCccCCCCcceEEeeccCccccccCCCCcCCCCcccCCCCCcc
Q 010849          197 KCEVCHQYIPTNGAGLIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLE  244 (499)
Q Consensus       197 kC~~C~~~I~~~~~g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~  244 (499)
                      +|..|+++|.+.. ..+.+...          .||..||+|..|++.+
T Consensus         1 ~C~~C~~~i~~~~-~~~~~~~~----------~~H~~Cf~C~~C~~~L   37 (39)
T smart00132        1 KCAGCGKPIRGGE-LVLRALGK----------VWHPECFKCSKCGKPL   37 (39)
T ss_pred             CccccCCcccCCc-EEEEeCCc----------cccccCCCCcccCCcC
Confidence            5889999998852 23333221          2499999999999854


No 20 
>KOG1702 consensus Nebulin repeat protein [Cytoskeleton]
Probab=96.41  E-value=0.00037  Score=67.26  Aligned_cols=59  Identities=19%  Similarity=0.507  Sum_probs=53.1

Q ss_pred             CCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhhhc
Q 010849          136 KVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKELT  194 (499)
Q Consensus       136 ~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f  194 (499)
                      ..|..|++.+.+-+-+.++++.||..||.|..|+-+|....+-..+.++||..+|.+..
T Consensus         5 ~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq~   63 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQV   63 (264)
T ss_pred             chhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCcccccce
Confidence            45888999998888899999999999999999999999888888899999999998754


No 21 
>PF10026 DUF2268:  Predicted Zn-dependent protease (DUF2268);  InterPro: IPR018728  This domain, found in various hypothetical bacterial proteins, as well as predicted zinc dependent proteases, has no known function. 
Probab=91.65  E-value=0.66  Score=44.77  Aligned_cols=45  Identities=20%  Similarity=0.179  Sum_probs=35.0

Q ss_pred             hHHHHHHHHHHHHHHHHHh------CCCCCChhhhhhHHHHHHHHHhhccc
Q 010849          376 LLTGAILAHELMHGWLRLK------GYRNLNPEVEEGICQVLSYMWLESEV  420 (499)
Q Consensus       376 l~~g~ilAHE~mHa~l~l~------g~~~l~~~veEG~Cq~~a~~wl~~~~  420 (499)
                      -..-+++|||+-|++..-.      +..-|+..|=||+-+.++..-.....
T Consensus        63 ~~l~~~iaHE~hH~~r~~~~~~~~~~~TLld~~I~EGlAe~f~~~~~g~~~  113 (195)
T PF10026_consen   63 EELPALIAHEYHHNCRYEQIGWDPEDTTLLDSLIMEGLAEYFAEELYGEEY  113 (195)
T ss_pred             HHHHHHHHHHHHHHHHHhccCCCCCCCCHHHHHHHhhHHHHHHHHHcCCCC
Confidence            4667999999999975542      34456899999999999988666554


No 22 
>PF01433 Peptidase_M1:  Peptidase family M1 This is family M1 in the peptidase classification.;  InterPro: IPR014782 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M1 (clan MA(E)), the type example being aminopeptidase N from Homo sapiens (Human). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA.  Membrane alanine aminopeptidase (3.4.11.2 from EC) is part of the HEXXH+E group; it consists entirely of aminopeptidases, spread across a wide variety of species []. Functional studies show that CD13/APN catalyzes the removal of single amino acids from the amino terminus of small peptides and probably plays a role in their final digestion; one family member (leukotriene-A4 hydrolase) is known to hydrolyse the epoxide leukotriene-A4 to form an inflammatory mediator []. This hydrolase has been shown to have aminopeptidase activity [], and the zinc ligands of the M1 family were identified by site-directed mutagenesis on this enzyme [] CD13 participates in trimming peptides bound to MHC class II molecules [] and cleaves MIP-1 chemokine, which alters target cell specificity from basophils to eosinophils []. CD13 acts as a receptor for specific strains of RNA viruses (coronaviruses) which cause a relatively large percentage of upper respiratory trace infections. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 2XQ0_A 2XPY_A 2XPZ_A 3SE6_B 3EBH_A 3EBG_A 3T8V_A 3Q44_A 3Q43_A 3EBI_A ....
Probab=86.50  E-value=0.5  Score=49.35  Aligned_cols=44  Identities=27%  Similarity=0.420  Sum_probs=33.2

Q ss_pred             HHHHHHHHHHHHHHHHHh-CCCCC-ChhhhhhHHHHHHHHHhhccc
Q 010849          377 LTGAILAHELMHGWLRLK-GYRNL-NPEVEEGICQVLSYMWLESEV  420 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~l~-g~~~l-~~~veEG~Cq~~a~~wl~~~~  420 (499)
                      ....++|||++|-|+--- ....- +..+-|||+++++++|++...
T Consensus       294 ~~~~~iahElahqWfGn~vt~~~w~d~WL~Eg~a~y~~~~~~~~~~  339 (390)
T PF01433_consen  294 EIASLIAHELAHQWFGNLVTPKWWSDLWLNEGFATYLEYLILEKLF  339 (390)
T ss_dssp             HHHHHHHHHHHTTTBTTTEEESSGGGHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHhccCCccccchhhhHHHHHHHHHHHHhHhhcc
Confidence            456889999999996421 11111 467999999999999999865


No 23 
>PF04450 BSP:  Peptidase of plants and bacteria;  InterPro: IPR007541 These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens [].
Probab=82.25  E-value=1.5  Score=42.93  Aligned_cols=91  Identities=20%  Similarity=0.266  Sum_probs=55.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHhCCCCCChhhhhhHHHHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCCCCCchHHHHHHHH
Q 010849          375 RLLTGAILAHELMHGWLRLKGYRNLNPEVEEGICQVLSYMWLESEVLPDYRNMPSTSSASTSSSSSKKGGKSEVEKKLGE  454 (499)
Q Consensus       375 rl~~g~ilAHE~mHa~l~l~g~~~l~~~veEG~Cq~~a~~wl~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~e~~l~~  454 (499)
                      +--...+|-|||||+|++-- ...-|.-+-|||-.++-+.   ....+..-  ..        ..+......-|  ...+
T Consensus        93 ~~Ei~Gvl~HE~~H~~Q~~~-~~~~P~~liEGIADyVRl~---aG~~~~~w--~~--------p~~~~~wd~gY--~~TA  156 (205)
T PF04450_consen   93 RDEIIGVLYHEMVHCWQWDG-RGTAPGGLIEGIADYVRLK---AGYAPPHW--KR--------PGGGDSWDDGY--RTTA  156 (205)
T ss_pred             HHHHHHHHHHHHHHHhhcCC-CCCCChhheecHHHHHHHH---cCCCCccc--cC--------CCCCCCccccc--HHHH
Confidence            45667899999999999874 3467999999999999766   11111000  00        00000011112  5567


Q ss_pred             HHHhhhhcCCCCCchhhH-HHHHHHHHHhCH
Q 010849          455 FFMHQIAHDASPAYGEGF-RIANAAVNKYGL  484 (499)
Q Consensus       455 ~~~~qi~~d~s~vYGdGf-R~~~~a~~~~gl  484 (499)
                      ||+.=+|...   ||.|| |..++++.+.+.
T Consensus       157 ~FL~wle~~~---~~~gfV~~LN~~m~~~~y  184 (205)
T PF04450_consen  157 RFLDWLEDNR---YGKGFVRRLNEAMRRDKY  184 (205)
T ss_pred             HHHHHHHhcc---cCccHHHHHHHHHhhCCC
Confidence            7777777622   56666 778888766443


No 24 
>PF14891 Peptidase_M91:  Effector protein
Probab=81.36  E-value=1  Score=42.69  Aligned_cols=20  Identities=30%  Similarity=0.448  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHHHhCC
Q 010849          377 LTGAILAHELMHGWLRLKGY  396 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~l~g~  396 (499)
                      .-..+|||||.|||=.++|-
T Consensus       102 ~p~v~L~HEL~HA~~~~~Gt  121 (174)
T PF14891_consen  102 PPFVVLYHELIHAYDYMNGT  121 (174)
T ss_pred             HHHHHHHHHHHHHHHHHCCC
Confidence            33589999999999999983


No 25 
>PF13699 DUF4157:  Domain of unknown function (DUF4157)
Probab=81.03  E-value=0.94  Score=37.71  Aligned_cols=18  Identities=44%  Similarity=0.547  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHhC
Q 010849          378 TGAILAHELMHGWLRLKG  395 (499)
Q Consensus       378 ~g~ilAHE~mHa~l~l~g  395 (499)
                      .-++|||||+|+++.-.|
T Consensus        61 ~~~llaHEl~Hv~Qq~~g   78 (79)
T PF13699_consen   61 GRALLAHELAHVVQQRRG   78 (79)
T ss_pred             cchhHhHHHHHHHhhccC
Confidence            457999999999987654


No 26 
>PF06114 DUF955:  Domain of unknown function (DUF955);  InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=80.87  E-value=2.3  Score=36.02  Aligned_cols=52  Identities=23%  Similarity=0.128  Sum_probs=35.1

Q ss_pred             EEEEEEcCCchhHHHHHHHHHHHHHHHHHhCC------CCCChhhhhhHHHHHHHHHh
Q 010849          365 TAILVLYGLPRLLTGAILAHELMHGWLRLKGY------RNLNPEVEEGICQVLSYMWL  416 (499)
Q Consensus       365 ~~Ilvl~gLPrl~~g~ilAHE~mHa~l~l~g~------~~l~~~veEG~Cq~~a~~wl  416 (499)
                      .-|+|=..++..-.-.+||||++|.++.-.+.      ........|=-++.+|...|
T Consensus        29 ~~I~in~~~~~~~~~f~laHELgH~~~~~~~~~~~~~~~~~~~~~~E~~An~fA~~lL   86 (122)
T PF06114_consen   29 PIIFINSNLSPERQRFTLAHELGHILLHHGDETFNYYLNYFFNERQEREANAFAAALL   86 (122)
T ss_dssp             TEEEEESSS-HHHHHHHHHHHHHHHHHHH-HHHHHHHHHH--THHHHHHHHHHHHHHH
T ss_pred             CEEEECCCCCHHHHHHHHHHHHHHHHhhhccccchhhccccchhhHHHHHHHHHHHHh
Confidence            36888888999999999999999999998752      23344444555555555544


No 27 
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=80.70  E-value=0.67  Score=44.51  Aligned_cols=17  Identities=53%  Similarity=0.575  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 010849          377 LTGAILAHELMHGWLRL  393 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~l  393 (499)
                      .+|+|||||||||+-..
T Consensus        35 ~lG~ilahel~hafd~~   51 (206)
T PF01431_consen   35 GLGFILAHELMHAFDPE   51 (206)
T ss_dssp             THHHHHHHHHHHCTSTT
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            47999999999998663


No 28 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=80.17  E-value=1.3  Score=40.62  Aligned_cols=22  Identities=23%  Similarity=0.087  Sum_probs=20.1

Q ss_pred             CchhHHHHHHHHHHHHHHHHHh
Q 010849          373 LPRLLTGAILAHELMHGWLRLK  394 (499)
Q Consensus       373 LPrl~~g~ilAHE~mHa~l~l~  394 (499)
                      .|.-.+-.+|+|||.|||+.+.
T Consensus        55 ~~~~~~~~tL~HEm~H~~~~~~   76 (157)
T PF10263_consen   55 NPEEELIDTLLHEMAHAAAYVF   76 (157)
T ss_pred             hHHHHHHHHHHHHHHHHHhhhc
Confidence            6777889999999999999998


No 29 
>TIGR02412 pepN_strep_liv aminopeptidase N, Streptomyces lividans type. This family is a subset of the members of the zinc metallopeptidase family M1 (pfam01433), with a single member characterized in Streptomyces lividans 66 and designated aminopeptidase N. The spectrum of activity may differ somewhat from the aminopeptidase N clade of E. coli and most other Proteobacteria, well separated phylogenetically within the M1 family. The M1 family also includes leukotriene A-4 hydrolase/aminopeptidase (with a bifunctional active site).
Probab=80.14  E-value=8.3  Score=45.30  Aligned_cols=42  Identities=17%  Similarity=0.295  Sum_probs=31.2

Q ss_pred             HHHHHHHHHHHHHHH-HhCCCC-CChhhhhhHHHHHHHHHhhcc
Q 010849          378 TGAILAHELMHGWLR-LKGYRN-LNPEVEEGICQVLSYMWLESE  419 (499)
Q Consensus       378 ~g~ilAHE~mHa~l~-l~g~~~-l~~~veEG~Cq~~a~~wl~~~  419 (499)
                      ...++|||+.|-|.- |=.... =+..+-|||..+++++|++..
T Consensus       287 ~~~viaHElAHqWFGnlVT~~wW~dlWLnEGFAty~e~~~~~~~  330 (831)
T TIGR02412       287 RAGVILHEMAHMWFGDLVTMRWWNDLWLNESFAEYMGTLASAEA  330 (831)
T ss_pred             HHHHHHHHHHHHHhCCEeccccccchhHHHHHHHHHHHHHHHhc
Confidence            357999999999973 111111 256899999999999999853


No 30 
>PRK03001 M48 family peptidase; Provisional
Probab=77.90  E-value=0.96  Score=46.14  Aligned_cols=20  Identities=30%  Similarity=0.234  Sum_probs=16.1

Q ss_pred             CCchhHHHHHHHHHHHHHHH
Q 010849          372 GLPRLLTGAILAHELMHGWL  391 (499)
Q Consensus       372 gLPrl~~g~ilAHE~mHa~l  391 (499)
                      .|...-..+|||||+.|.--
T Consensus       118 ~l~~~El~aVlAHElgHi~~  137 (283)
T PRK03001        118 VLSEREIRGVMAHELAHVKH  137 (283)
T ss_pred             hCCHHHHHHHHHHHHHHHhC
Confidence            45677788999999999753


No 31 
>PRK01345 heat shock protein HtpX; Provisional
Probab=76.49  E-value=1.2  Score=46.48  Aligned_cols=19  Identities=32%  Similarity=0.288  Sum_probs=15.7

Q ss_pred             CchhHHHHHHHHHHHHHHH
Q 010849          373 LPRLLTGAILAHELMHGWL  391 (499)
Q Consensus       373 LPrl~~g~ilAHE~mHa~l  391 (499)
                      |...-..+|||||+.|.-.
T Consensus       119 L~~dEL~aVlAHElgHi~~  137 (317)
T PRK01345        119 LSPEEVAGVMAHELAHVKN  137 (317)
T ss_pred             CCHHHHHHHHHHHHHHHHc
Confidence            5667788999999999764


No 32 
>PRK02391 heat shock protein HtpX; Provisional
Probab=74.66  E-value=1.3  Score=45.76  Aligned_cols=21  Identities=38%  Similarity=0.177  Sum_probs=16.7

Q ss_pred             cCCchhHHHHHHHHHHHHHHH
Q 010849          371 YGLPRLLTGAILAHELMHGWL  391 (499)
Q Consensus       371 ~gLPrl~~g~ilAHE~mHa~l  391 (499)
                      ..|...-..+|||||+.|.--
T Consensus       126 ~~L~~~El~aVlaHElgHi~~  146 (296)
T PRK02391        126 RRLDPDELEAVLAHELSHVKN  146 (296)
T ss_pred             hhCCHHHHHHHHHHHHHHHHc
Confidence            456677788999999999643


No 33 
>KOG1702 consensus Nebulin repeat protein [Cytoskeleton]
Probab=74.43  E-value=0.57  Score=45.74  Aligned_cols=97  Identities=15%  Similarity=0.277  Sum_probs=57.7

Q ss_pred             cccccccCCccCCCCcceEEeeccCccccccCCCCcCCCCcccCCCCCccccCCceeEecCCccccchhhhhhccCCCCC
Q 010849          195 HPKCEVCHQYIPTNGAGLIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNTRYYSLEDGRSLCLECMESAIMDTGDC  274 (499)
Q Consensus       195 ~pkC~~C~~~I~~~~~g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sav~dt~e~  274 (499)
                      .+.|..|++.+.+.+  .+. ....||         |..||+|..|+.  ++.-+.+.-.|.++||-.+|..-+..+---
T Consensus         4 k~n~~~cgk~vYPvE--~v~-cldk~w---------hk~cfkce~c~m--tlnmKnyKgy~kkpycn~hYpkq~at~~ad   69 (264)
T KOG1702|consen    4 KCNREDCGKTVYPVE--EVK-CLDKVW---------HKQCFKCEVCGM--TLNMKNYKGYDKKPYCNPHYPKQVATVMAD   69 (264)
T ss_pred             cchhhhhccccccHH--HHh-hHHHHH---------HHHhheeeeccC--ChhhhhccccccCCCcCcccccceeeeecC
Confidence            345677877766532  111 123456         999999999997  555555665678999999996554433222


Q ss_pred             CchhhhHHH------------HHhhcccccccccccccccHHHHHHHH
Q 010849          275 QPLYHAIRD------------YYEGMNMKLDQQIPMLLVERQALNEAI  310 (499)
Q Consensus       275 qpl~~~i~~------------f~~g~~m~~~~~~p~~lv~~~~ln~a~  310 (499)
                      .|-...|.+            -|+.+     .+-|.++.|-++|.+.-
T Consensus        70 TPEm~Rik~n~enqS~vkY~~e~ekm-----KG~~s~iaDtPem~r~K  112 (264)
T KOG1702|consen   70 TPEMRRIKENTENQSNVKYHAEYEKM-----KGTKSEIADTPEMERLK  112 (264)
T ss_pred             CHHHHHHHhhhccchhhhhHHHHHHh-----cCCcceecCCHHHHHHH
Confidence            233333321            22221     23466777888887653


No 34 
>PRK03072 heat shock protein HtpX; Provisional
Probab=73.20  E-value=1.3  Score=45.50  Aligned_cols=21  Identities=33%  Similarity=0.336  Sum_probs=16.8

Q ss_pred             EcCCchhHHHHHHHHHHHHHH
Q 010849          370 LYGLPRLLTGAILAHELMHGW  390 (499)
Q Consensus       370 l~gLPrl~~g~ilAHE~mHa~  390 (499)
                      |.-|++.-..+|||||+.|.-
T Consensus       119 l~~l~~~El~aVlAHElgHi~  139 (288)
T PRK03072        119 LQILNERELRGVLGHELSHVY  139 (288)
T ss_pred             HHhCCHHHHHHHHHHHHHHHh
Confidence            355677778899999999954


No 35 
>PF10460 Peptidase_M30:  Peptidase M30;  InterPro: IPR019501 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This family contains metallopeptidases belonging to MEROPS peptidase family M30 (hyicolysin family, clan MA). Hyicolysin has a zinc ion which is liganded by two histidine and one glutamate residue. 
Probab=72.56  E-value=4.8  Score=42.88  Aligned_cols=44  Identities=18%  Similarity=0.151  Sum_probs=32.6

Q ss_pred             hHHHHHHHHHHHHH---HHHH--hCC-CCCChhhhhhHHHHHHHHHhhcc
Q 010849          376 LLTGAILAHELMHG---WLRL--KGY-RNLNPEVEEGICQVLSYMWLESE  419 (499)
Q Consensus       376 l~~g~ilAHE~mHa---~l~l--~g~-~~l~~~veEG~Cq~~a~~wl~~~  419 (499)
                      -.+-++||||++|.   |.+.  .|- ...+..++||+-+++.++.-...
T Consensus       137 ~~~~sTlAHEfQHmInfy~~~v~~g~~~~~dtWLnE~lS~~aEdl~s~~~  186 (366)
T PF10460_consen  137 DTVYSTLAHEFQHMINFYQRGVLHGKQYAMDTWLNEMLSMSAEDLYSSKI  186 (366)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcCCCcccccHHHHHHHHHHHHHHhcCC
Confidence            34679999999986   4432  332 35799999999999999765443


No 36 
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=70.77  E-value=3.6  Score=37.79  Aligned_cols=22  Identities=41%  Similarity=0.333  Sum_probs=18.2

Q ss_pred             chhHHHHHHHHHHHHHHHHHhC
Q 010849          374 PRLLTGAILAHELMHGWLRLKG  395 (499)
Q Consensus       374 Prl~~g~ilAHE~mHa~l~l~g  395 (499)
                      |...+-.||+|||.|++..+.|
T Consensus        55 ~~~~l~~~l~HEm~H~~~~~~g   76 (146)
T smart00731       55 GRDRLRETLLHELCHAALYLFG   76 (146)
T ss_pred             cHHHHHhhHHHHHHHHHHHHhC
Confidence            4456677999999999999865


No 37 
>PRK14015 pepN aminopeptidase N; Provisional
Probab=70.52  E-value=15  Score=43.67  Aligned_cols=41  Identities=20%  Similarity=0.399  Sum_probs=28.9

Q ss_pred             HHHHHHHHHHHHHHHHhCC--CCC-ChhhhhhHHHHHHHHHhhcc
Q 010849          378 TGAILAHELMHGWLRLKGY--RNL-NPEVEEGICQVLSYMWLESE  419 (499)
Q Consensus       378 ~g~ilAHE~mHa~l~l~g~--~~l-~~~veEG~Cq~~a~~wl~~~  419 (499)
                      ..+|+|||+.|-|.- |-.  ..- +..+-||+.-++.++|.+..
T Consensus       296 i~~vIaHElaHqWFG-NlVT~~~W~dLWLnEGFAty~e~~~~~~~  339 (875)
T PRK14015        296 IESVIAHEYFHNWTG-NRVTCRDWFQLSLKEGLTVFRDQEFSADL  339 (875)
T ss_pred             HHHHHHHHHHHHHHh-CcceecchhhhhhhhHHHHHHHHHHHHHh
Confidence            568999999999941 111  111 35679999999988887653


No 38 
>PRK02870 heat shock protein HtpX; Provisional
Probab=68.55  E-value=1.9  Score=45.31  Aligned_cols=18  Identities=44%  Similarity=0.412  Sum_probs=15.2

Q ss_pred             CCchhHHHHHHHHHHHHH
Q 010849          372 GLPRLLTGAILAHELMHG  389 (499)
Q Consensus       372 gLPrl~~g~ilAHE~mHa  389 (499)
                      -|++.-..+|||||+.|.
T Consensus       167 ~L~~dEL~aVlAHELgHi  184 (336)
T PRK02870        167 KLDRDELQAVMAHELSHI  184 (336)
T ss_pred             hCCHHHHHHHHHHHHHHH
Confidence            456677889999999997


No 39 
>PRK03982 heat shock protein HtpX; Provisional
Probab=68.31  E-value=1.9  Score=44.13  Aligned_cols=20  Identities=30%  Similarity=0.119  Sum_probs=16.3

Q ss_pred             CCchhHHHHHHHHHHHHHHH
Q 010849          372 GLPRLLTGAILAHELMHGWL  391 (499)
Q Consensus       372 gLPrl~~g~ilAHE~mHa~l  391 (499)
                      .|...-..+|||||+.|.--
T Consensus       119 ~l~~~El~AVlAHElgHi~~  138 (288)
T PRK03982        119 LLNEDELEGVIAHELTHIKN  138 (288)
T ss_pred             hCCHHHHHHHHHHHHHHHHc
Confidence            45777789999999999753


No 40 
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism]
Probab=68.07  E-value=11  Score=37.36  Aligned_cols=55  Identities=20%  Similarity=0.056  Sum_probs=42.0

Q ss_pred             EEEEEEcCCchhHHHHHHHHHHHHHHHHHhC------CCC-CChhhhhhHHHHHHHHHhhcc
Q 010849          365 TAILVLYGLPRLLTGAILAHELMHGWLRLKG------YRN-LNPEVEEGICQVLSYMWLESE  419 (499)
Q Consensus       365 ~~Ilvl~gLPrl~~g~ilAHE~mHa~l~l~g------~~~-l~~~veEG~Cq~~a~~wl~~~  419 (499)
                      .-|++---++-..---+|||||.||+|--.+      .++ -....-|=.|+.+|-..|-..
T Consensus        59 ~~I~iN~n~~~~r~rFtlAHELGH~llH~~~~~~~~~~~~~~~~~~~E~~AN~FAa~lLmP~  120 (213)
T COG2856          59 PVIYINANNSLERKRFTLAHELGHALLHTDLNTRFDAEPTLQQDRKIEAEANAFAAELLMPE  120 (213)
T ss_pred             ceEEEeCCCCHHHHHHHHHHHHhHHHhccccchhhhcccccchhHHHHHHHHHHHHHHhCCh
Confidence            4677777778888889999999999997765      122 244556778999999888765


No 41 
>PRK04897 heat shock protein HtpX; Provisional
Probab=67.52  E-value=1.9  Score=44.52  Aligned_cols=20  Identities=20%  Similarity=0.169  Sum_probs=16.6

Q ss_pred             cCCchhHHHHHHHHHHHHHH
Q 010849          371 YGLPRLLTGAILAHELMHGW  390 (499)
Q Consensus       371 ~gLPrl~~g~ilAHE~mHa~  390 (499)
                      ..|++.-..+|||||+.|.-
T Consensus       130 ~~l~~~El~aVlAHElgHi~  149 (298)
T PRK04897        130 AIMNREELEGVIGHEISHIR  149 (298)
T ss_pred             hhCCHHHHHHHHHHHHHHHh
Confidence            45677888999999999954


No 42 
>PRK05457 heat shock protein HtpX; Provisional
Probab=66.97  E-value=2.3  Score=43.59  Aligned_cols=21  Identities=38%  Similarity=0.379  Sum_probs=17.5

Q ss_pred             EcCCchhHHHHHHHHHHHHHH
Q 010849          370 LYGLPRLLTGAILAHELMHGW  390 (499)
Q Consensus       370 l~gLPrl~~g~ilAHE~mHa~  390 (499)
                      |.-|++--..+|||||+.|.-
T Consensus       126 l~~L~~~El~aVlAHElgHi~  146 (284)
T PRK05457        126 LQNMSRDEVEAVLAHEISHIA  146 (284)
T ss_pred             hhhCCHHHHHHHHHHHHHHHH
Confidence            345788899999999999963


No 43 
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only]
Probab=66.47  E-value=2  Score=41.58  Aligned_cols=94  Identities=20%  Similarity=0.312  Sum_probs=66.1

Q ss_pred             CCccccc--chHHHHHHhh--cccCCCCCCCCCCCCCCC--CCCCCCCCCCCccCCCc-eEeecCccccCCCcccCCCCC
Q 010849           98 GQRWRSN--TDEDYAWALQ--DSQLNPSFPPYDPSHYYP--RSYKVCGGCNCDIGYGN-YLGCMGTYFHPNCFRCRSCGY  170 (499)
Q Consensus        98 ~~~wh~e--~ce~c~r~Lq--~~l~~~~~~pyC~~~y~~--~~~~~C~~C~k~I~~g~-~l~algk~wHp~CF~C~~C~~  170 (499)
                      ...||..  .|..|...+.  .......+..||..+|..  .....|.+|...+..-+ +..+..++ |-.||.|..|..
T Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~d~~~~~~~~~rr~rt~~~~~ql~~ler~f~~~-h~Pd~~~r~~la   94 (235)
T KOG0490|consen   16 DRYWHASCLKCAECDNPLGVGDTCFSKDGSIYCKRDYQREFKFSKRCARCKFTISQLDELERAFEKV-HLPCFACRECLA   94 (235)
T ss_pred             cHHHHHHHHhhhhhcchhccCCCcccCCCcccccccchhhhhccccccCCCCCcCHHHHHHHhhcCC-CcCccchHHHHh
Confidence            4467755  5666666664  222222347899999977  67889999999985433 34566677 999999999998


Q ss_pred             CCC-CCceEeeCC-cccchhhhhh
Q 010849          171 PIT-EHEFSLSGK-DPYHKSCFKE  192 (499)
Q Consensus       171 ~L~-~~~F~~~dg-~~YC~~CY~~  192 (499)
                      .+. ..++.+... +.+|..++.+
T Consensus        95 ~~~~~~e~rVqvwFqnrrak~r~~  118 (235)
T KOG0490|consen   95 LLLTGDEFRVQVWFQNRRAKDRKE  118 (235)
T ss_pred             hcCCCCeeeeehhhhhhcHhhhhh
Confidence            665 446777655 8888877765


No 44 
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=65.80  E-value=3.5  Score=39.57  Aligned_cols=48  Identities=21%  Similarity=0.504  Sum_probs=38.6

Q ss_pred             CCCcccCCCCCCCCCCc-eEeeCCcccchhhhhhhc--cccccccCCccCC
Q 010849          160 PNCFRCRSCGYPITEHE-FSLSGKDPYHKSCFKELT--HPKCEVCHQYIPT  207 (499)
Q Consensus       160 p~CF~C~~C~~~L~~~~-F~~~dg~~YC~~CY~~~f--~pkC~~C~~~I~~  207 (499)
                      ..||.|..|=.+..... +..+-|.+||+.|.+...  +-+|..|++.|..
T Consensus       129 ~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~  179 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITH  179 (187)
T ss_pred             ccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccch
Confidence            35788888887777654 667889999999998754  6789999998875


No 45 
>PF09768 Peptidase_M76:  Peptidase M76 family;  InterPro: IPR019165 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. Mitochondrial inner membrane protease ATP23 has two roles in the assembly of mitochondrial ATPase. Firstly, it acts as a protease that removes the N-terminal 10 residues of mitochondrial ATPase CF(0) subunit 6 (ATP6) at the intermembrane space side. Secondly, it is involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of ATP6 with the subunit 9 ring [, ].; GO: 0004222 metalloendopeptidase activity
Probab=65.43  E-value=4.6  Score=38.65  Aligned_cols=22  Identities=23%  Similarity=0.338  Sum_probs=18.2

Q ss_pred             chhHHHHHHHHHHHHHHHHHhC
Q 010849          374 PRLLTGAILAHELMHGWLRLKG  395 (499)
Q Consensus       374 Prl~~g~ilAHE~mHa~l~l~g  395 (499)
                      -+.....+|+|||.|||=.+..
T Consensus        67 ~~~~l~~~l~HELIHayD~cr~   88 (173)
T PF09768_consen   67 SQGHLEDTLTHELIHAYDHCRA   88 (173)
T ss_pred             CHHHHHHHHHHHHHHHHHHHhc
Confidence            3456678999999999988874


No 46 
>PRK01265 heat shock protein HtpX; Provisional
Probab=65.23  E-value=2.5  Score=44.29  Aligned_cols=17  Identities=41%  Similarity=0.311  Sum_probs=14.4

Q ss_pred             CchhHHHHHHHHHHHHH
Q 010849          373 LPRLLTGAILAHELMHG  389 (499)
Q Consensus       373 LPrl~~g~ilAHE~mHa  389 (499)
                      |.+.-..+|||||+.|.
T Consensus       135 l~~~El~aVlAHElgHi  151 (324)
T PRK01265        135 LNRDEIKAVAGHELGHL  151 (324)
T ss_pred             CCHHHHHHHHHHHHHHH
Confidence            56677889999999994


No 47 
>PHA02456 zinc metallopeptidase motif-containing protein
Probab=62.37  E-value=4.8  Score=35.91  Aligned_cols=15  Identities=47%  Similarity=0.683  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHHh
Q 010849          380 AILAHELMHGWLRLK  394 (499)
Q Consensus       380 ~ilAHE~mHa~l~l~  394 (499)
                      -.||||+.|||+.-.
T Consensus        81 ~TL~HEL~H~WQ~Rs   95 (141)
T PHA02456         81 DTLAHELNHAWQFRT   95 (141)
T ss_pred             HHHHHHHHHHHhhhc
Confidence            679999999999765


No 48 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=61.08  E-value=8  Score=31.25  Aligned_cols=46  Identities=22%  Similarity=0.406  Sum_probs=22.4

Q ss_pred             cccCCCCCCCCCCceEeeCCcccchhhhhhhccccccccCCccCCC
Q 010849          163 FRCRSCGYPITEHEFSLSGKDPYHKSCFKELTHPKCEVCHQYIPTN  208 (499)
Q Consensus       163 F~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~pkC~~C~~~I~~~  208 (499)
                      .+|+.|..-+...-....=...||..|....++..|.+|+.|-...
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~CPvC~~Paw~q   53 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSECPVCHTPAWIQ   53 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-SSS--B-S-S
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCCCCcCChHHHH
Confidence            4677777666542223345688999999998899999999886543


No 49 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=60.21  E-value=7.3  Score=44.56  Aligned_cols=49  Identities=22%  Similarity=0.497  Sum_probs=25.5

Q ss_pred             CCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhhhc--cccccccCCccC
Q 010849          136 KVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKELT--HPKCEVCHQYIP  206 (499)
Q Consensus       136 ~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f--~pkC~~C~~~I~  206 (499)
                      .+|..|+..+..+.             -.|..|+.+|..         ..|..|-...-  ...|..|+....
T Consensus         2 ~~Cp~Cg~~n~~~a-------------kFC~~CG~~l~~---------~~Cp~CG~~~~~~~~fC~~CG~~~~   52 (645)
T PRK14559          2 LICPQCQFENPNNN-------------RFCQKCGTSLTH---------KPCPQCGTEVPVDEAHCPNCGAETG   52 (645)
T ss_pred             CcCCCCCCcCCCCC-------------ccccccCCCCCC---------CcCCCCCCCCCcccccccccCCccc
Confidence            46888888774321             235666666632         13555544421  334666665543


No 50 
>PF01447 Peptidase_M4:  Thermolysin metallopeptidase, catalytic domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. ;  InterPro: IPR013856 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases that belong to the MEROPS peptidase family M4 (thermolysin family, clan MA(E)). The protein fold of the peptidase domain of thermolysin, is the type example for members of the clan MA. The thermolysin family is composed only of secreted eubacterial endopeptidases. The zinc-binding residues are H-142, H-146 and E-166, with E-143 acting as the catalytic residue. Thermolysin also contains 4 calcium-binding sites, which contribute to its unusual thermostability. The family also includes enzymes from a number of pathogens, including Legionella and Listeria, and the protein pseudolysin, all with a substrate specificity for an aromatic residue in the P1' position. Three-dimensional structure analysis has shown that the enzymes undergo a hinge-bend motion during catalysis. Pseudolysin has a broader specificity, acting on large molecules such as elastin and collagen, possibly due to its wider active site cleft []. This entry represents a domain found in peptidase M4 family members.; GO: 0004222 metalloendopeptidase activity; PDB: 3NQX_A 3NQZ_B 3NQY_B 1BQB_A 1U4G_A 1EZM_A 3DBK_A 1ESP_A 1NPC_A 1LND_E ....
Probab=58.35  E-value=6.1  Score=36.84  Aligned_cols=18  Identities=39%  Similarity=0.499  Sum_probs=12.5

Q ss_pred             chhHHHHHHHHHHHHHHH
Q 010849          374 PRLLTGAILAHELMHGWL  391 (499)
Q Consensus       374 Prl~~g~ilAHE~mHa~l  391 (499)
                      |-.-..=|+||||+|+..
T Consensus       131 ~~~~~lDVvaHEltHGVt  148 (150)
T PF01447_consen  131 PFASSLDVVAHELTHGVT  148 (150)
T ss_dssp             -GGG-HHHHHHHHHHHHH
T ss_pred             cCccccceeeeccccccc
Confidence            333346799999999864


No 51 
>TIGR02411 leuko_A4_hydro leukotriene A-4 hydrolase/aminopeptidase. Members of this family represent a distinctive subset within the zinc metallopeptidase family M1 (pfam01433). The majority of the members of pfam01433 are aminopeptidases, but the sequences in this family for which the function is known are leukotriene A-4 hydrolase. A dual epoxide hydrolase and aminopeptidase activity at the same active site is indicated. The physiological substrate for aminopeptidase activity is not known.
Probab=57.53  E-value=8.8  Score=43.49  Aligned_cols=40  Identities=23%  Similarity=0.221  Sum_probs=29.0

Q ss_pred             HHHHHHHHHHHHHHHh-CCCCC-ChhhhhhHHHHHHHHHhhc
Q 010849          379 GAILAHELMHGWLRLK-GYRNL-NPEVEEGICQVLSYMWLES  418 (499)
Q Consensus       379 g~ilAHE~mHa~l~l~-g~~~l-~~~veEG~Cq~~a~~wl~~  418 (499)
                      ..++|||++|-|.--- ....= +..+-||+.-++.+.+++.
T Consensus       280 ~~viaHElAHqWfGNlVT~~~W~d~WLnEGfaty~e~~~~~~  321 (601)
T TIGR02411       280 VDVIAHELAHSWSGNLVTNCSWEHFWLNEGWTVYLERRIVGR  321 (601)
T ss_pred             hhhHHHHHHhhccCceeecCCchHHHHHhhHHHHHHHHHHHH
Confidence            4799999999997421 11111 5678999999999877654


No 52 
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily. TACE, the tumor-necrosis factor-alpha converting enzyme, releases soluble TNF-alpha from transmembrane pro-TNF-alpha.
Probab=57.29  E-value=6.6  Score=39.28  Aligned_cols=18  Identities=33%  Similarity=0.538  Sum_probs=15.4

Q ss_pred             CchhHHHHHHHHHHHHHH
Q 010849          373 LPRLLTGAILAHELMHGW  390 (499)
Q Consensus       373 LPrl~~g~ilAHE~mHa~  390 (499)
                      +|...+..++||||.|.|
T Consensus       162 ~~~~~~a~t~AHElGHnl  179 (244)
T cd04270         162 VPTKESDLVTAHELGHNF  179 (244)
T ss_pred             cchhHHHHHHHHHHHHhc
Confidence            466778899999999986


No 53 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=56.71  E-value=7.5  Score=36.59  Aligned_cols=54  Identities=19%  Similarity=0.506  Sum_probs=36.3

Q ss_pred             CcccchhhhhhhccccccccCCccCCCC--cceEEeeccCccccccCCCCcCCCCcccCCCCCccccCC
Q 010849          182 KDPYHKSCFKELTHPKCEVCHQYIPTNG--AGLIEYRCHPFWAQKYCPSHEHDHTSRCCSCERLESWNT  248 (499)
Q Consensus       182 g~~YC~~CY~~~f~pkC~~C~~~I~~~~--~g~I~~~~~pfWgq~YCp~H~H~~CF~C~~C~r~~~~g~  248 (499)
                      .+-||.+|-.+ .-..|..|+.+|.|..  .|.+.+.      ..|     +.-- -|..|+++.|...
T Consensus        27 ~~~fC~kCG~~-tI~~Cp~C~~~IrG~y~v~gv~~~g------~~~-----~~Ps-YC~~CGkpyPWt~   82 (158)
T PF10083_consen   27 REKFCSKCGAK-TITSCPNCSTPIRGDYHVEGVFGLG------GHY-----EAPS-YCHNCGKPYPWTE   82 (158)
T ss_pred             HHHHHHHhhHH-HHHHCcCCCCCCCCceecCCeeeeC------CCC-----CCCh-hHHhCCCCCchHH
Confidence            46789999776 5678999999999973  4555442      122     2111 2889999877643


No 54 
>PRK04351 hypothetical protein; Provisional
Probab=56.53  E-value=9.7  Score=35.53  Aligned_cols=20  Identities=40%  Similarity=0.431  Sum_probs=16.8

Q ss_pred             hHHHHHHHHHHHHHHHHHhC
Q 010849          376 LLTGAILAHELMHGWLRLKG  395 (499)
Q Consensus       376 l~~g~ilAHE~mHa~l~l~g  395 (499)
                      ..+..||+|||.|+.+.+.|
T Consensus        59 ~~l~~vv~HElcH~~~~~~g   78 (149)
T PRK04351         59 EELIGIIKHELCHYHLHLEG   78 (149)
T ss_pred             HHHHhhHHHHHHHHHHHHHC
Confidence            34568999999999999875


No 55 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=55.70  E-value=9.8  Score=38.68  Aligned_cols=110  Identities=18%  Similarity=0.417  Sum_probs=65.2

Q ss_pred             chHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCCCCCCCcc---CCCc--------eEeecC---c------cc--cC-C
Q 010849          105 TDEDYAWALQDSQLNPSFPPYDPSHYYPRSYKVCGGCNCDI---GYGN--------YLGCMG---T------YF--HP-N  161 (499)
Q Consensus       105 ~ce~c~r~Lq~~l~~~~~~pyC~~~y~~~~~~~C~~C~k~I---~~g~--------~l~alg---k------~w--Hp-~  161 (499)
                      +|+.|.+.-.       ++.||-.|....-.|+|+.|++.-   ..|.        +.+-++   .      .|  |- .
T Consensus        40 eCdkC~r~QK-------nRAFCYFC~s~qrlp~Ca~Cgk~KCm~k~gdCvvkH~g~~~tGl~mvGaiCDfCEawvCHgrk  112 (314)
T PF06524_consen   40 ECDKCQRKQK-------NRAFCYFCQSVQRLPMCAHCGKTKCMLKTGDCVVKHPGVFTTGLGMVGAICDFCEAWVCHGRK  112 (314)
T ss_pred             cchhhhhhcc-------ccceeehhhhhhcCchhhhcCCeeeeccCCCeEEecCceeecccchhhhhhccchhheecccc
Confidence            7888876421       256666666666789999999862   2232        222221   1      23  43 5


Q ss_pred             CcccCCCCCCCCCCce-------EeeCCcccchhhhhhhccccccccCCccCCCCcceEEeeccCccccccCCCCcCCCC
Q 010849          162 CFRCRSCGYPITEHEF-------SLSGKDPYHKSCFKELTHPKCEVCHQYIPTNGAGLIEYRCHPFWAQKYCPSHEHDHT  234 (499)
Q Consensus       162 CF~C~~C~~~L~~~~F-------~~~dg~~YC~~CY~~~f~pkC~~C~~~I~~~~~g~I~~~~~pfWgq~YCp~H~H~~C  234 (499)
                      |+.-+.|..||.+...       +.++|++|           +|.-|..++-..+         .|-.|.-|..- -...
T Consensus       113 Cl~~HaC~Cpl~da~C~EC~R~vw~hGGrif-----------~CsfC~~flCEDD---------QFEHQAsCQvL-e~E~  171 (314)
T PF06524_consen  113 CLSTHACTCPLQDAVCIECERGVWDHGGRIF-----------KCSFCDNFLCEDD---------QFEHQASCQVL-ESET  171 (314)
T ss_pred             ccccccccCcCCCcEeeeeecccccCCCeEE-----------EeecCCCeeeccc---------hhhhhhhhhhh-hccc
Confidence            8888889999986532       23344433           5888888776542         12222223222 4567


Q ss_pred             cccCCCCC
Q 010849          235 SRCCSCER  242 (499)
Q Consensus       235 F~C~~C~r  242 (499)
                      |+|.+|+|
T Consensus       172 ~KC~SCNr  179 (314)
T PF06524_consen  172 FKCQSCNR  179 (314)
T ss_pred             cccccccc
Confidence            99999998


No 56 
>PF01435 Peptidase_M48:  Peptidase family M48 This is family M48 in the peptidase classification. ;  InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated.  The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases [].  HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=54.55  E-value=9  Score=36.61  Aligned_cols=23  Identities=39%  Similarity=0.170  Sum_probs=18.5

Q ss_pred             CchhHHHHHHHHHHHHHHHHHhC
Q 010849          373 LPRLLTGAILAHELMHGWLRLKG  395 (499)
Q Consensus       373 LPrl~~g~ilAHE~mHa~l~l~g  395 (499)
                      ++..-..+|||||+.|...+-.-
T Consensus        84 ~~~~el~aVlaHElgH~~~~h~~  106 (226)
T PF01435_consen   84 LSEDELAAVLAHELGHIKHRHIL  106 (226)
T ss_dssp             SSHHHHHHHHHHHHHHHHTTHCC
T ss_pred             ccHHHHHHHHHHHHHHHHcCCcc
Confidence            45666779999999999977653


No 57 
>smart00726 UIM Ubiquitin-interacting motif. Present in proteasome subunit S5a and other ubiquitin-associated proteins.
Probab=54.25  E-value=7  Score=25.91  Aligned_cols=20  Identities=40%  Similarity=0.521  Sum_probs=16.7

Q ss_pred             hhhhHHHHHHhcchhhhcCc
Q 010849           77 EKEELDHAIALSLAEDLKRP   96 (499)
Q Consensus        77 e~edid~ai~~sL~Ee~kk~   96 (499)
                      |+|+|.+||.+|+.|.+...
T Consensus         2 EDe~Lq~Ai~lSl~e~e~~~   21 (26)
T smart00726        2 EDEDLQLALELSLQEAEESX   21 (26)
T ss_pred             hHHHHHHHHHHhHHHhhhcc
Confidence            68999999999998876543


No 58 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=54.09  E-value=15  Score=28.11  Aligned_cols=44  Identities=16%  Similarity=0.227  Sum_probs=33.2

Q ss_pred             cccCCCCCCCCCCceEeeCCcccchhhhhhhc--cccccccCCccCC
Q 010849          163 FRCRSCGYPITEHEFSLSGKDPYHKSCFKELT--HPKCEVCHQYIPT  207 (499)
Q Consensus       163 F~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f--~pkC~~C~~~I~~  207 (499)
                      |.|..|+..+.+ ......|..||+.|..+.+  ..+|..|++++..
T Consensus         2 ~~Cpi~~~~~~~-Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~   47 (63)
T smart00504        2 FLCPISLEVMKD-PVILPSGQTYERRAIEKWLLSHGTDPVTGQPLTH   47 (63)
T ss_pred             cCCcCCCCcCCC-CEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCCh
Confidence            568888888776 4555678999999987643  5678888888754


No 59 
>PF02809 UIM:  Ubiquitin interaction motif;  InterPro: IPR003903 The Ubiquitin Interacting Motif (UIM), or 'LALAL-motif', is a stretch of about 20 amino acid residues, which was first described in the 26S proteasome subunit PSD4/RPN-10 that is known to recognise ubiquitin [,]. In addition, the UIM is found, often in tandem or triplet arrays, in a variety of proteins either involved in ubiquitination and ubiquitin metabolism, or known to interact with ubiquitin-like modifiers. Among the UIM proteins are two different subgroups of the UBP (ubiquitin carboxy-terminal hydrolase) family of deubiquitinating enzymes, one F-box protein, one family of HECT-containing ubiquitin-ligases (E3s) from plants, and several proteins containing ubiquitin-associated UBA and/or UBX domains []. In most of these proteins, the UIM occurs in multiple copies and in association with other domains such as UBA (IPR015940 from INTERPRO), UBX (IPR001012 from INTERPRO), ENTH, EH (IPR000261 from INTERPRO), VHS (IPR002014 from INTERPRO), SH3 (IPR001452 from INTERPRO), HECT (IPR000569 from INTERPRO), VWFA (IPR002035 from INTERPRO), EF-hand calcium-binding, WD-40 (IPR001680 from INTERPRO), F-box (IPR001810 from INTERPRO), LIM (IPR001781 from INTERPRO), protein kinase (IPR000719 from INTERPRO), ankyrin (IPR002110 from INTERPRO), PX (IPR001683 from INTERPRO), phosphatidylinositol 3- and 4-kinase (IPR000403 from INTERPRO), C2 (IPR000008 from INTERPRO), OTU (IPR003323 from INTERPRO), dnaJ (IPR001623 from INTERPRO), RING-finger (IPR001841 from INTERPRO) or FYVE-finger (IPR017455 from INTERPRO). UIMs have been shown to bind ubiquitin and to serve as a specific targeting signal important for monoubiquitination. Thus, UIMs may have several functions in ubiquitin metabolism each of which may require different numbers of UIMs [, , ].  The UIM is unlikely to form an independent folding domain. Instead, based on the spacing of the conserved residues, the motif probably forms a short alpha-helix that can be embedded into different protein folds []. Some proteins known to contain an UIM are listed below:    Eukaryotic PSD4/RPN-10/S5, a multi-ubiquitin binding subunit of the 26S proteasome.  Vertebrate Machado-Joseph disease protein 1 (Ataxin-3), which acts as a histone-binding protein that regulates transcription; defects in Ataxin-3 cause the neurodegenerative disorder Machado-Joseph disease (MJD). Vertebrate epsin and epsin2.  Vertebrate hepatocyte growth factor-regulated tyrosine kinase substrate (HRS).  Mammalian epidermal growth factor receptor substrate 15 (EPS15), which is involved in cell growth regulation.  Mammalian epidermal growth factor receptor substrate EPS15R.   Drosophila melanogaster (Fruit fly) liquid facets (lqf), an epsin.  Yeast VPS27 vacuolar sorting protein, which is required for membrane traffic to the vacuole.   ; PDB: 2KDE_A 2KDF_A 1YX6_A 1YX5_A 1YX4_A 1P9C_A 1UEL_B 1P9D_S 2KLZ_A.
Probab=53.57  E-value=7.1  Score=23.67  Aligned_cols=16  Identities=44%  Similarity=0.696  Sum_probs=13.7

Q ss_pred             hhhhhHHHHHHhcchh
Q 010849           76 REKEELDHAIALSLAE   91 (499)
Q Consensus        76 ~e~edid~ai~~sL~E   91 (499)
                      .|++++.+||.+|+.|
T Consensus         2 ~Ed~~L~~Al~~S~~e   17 (18)
T PF02809_consen    2 DEDEDLQRALEMSLEE   17 (18)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             chHHHHHHHHHhhhcc
Confidence            4788999999999865


No 60 
>PF04298 Zn_peptidase_2:  Putative neutral zinc metallopeptidase;  InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=53.05  E-value=12  Score=37.20  Aligned_cols=29  Identities=31%  Similarity=0.424  Sum_probs=23.2

Q ss_pred             cCCchhHHHHHHHHHHHHHHHHHhCCCCC
Q 010849          371 YGLPRLLTGAILAHELMHGWLRLKGYRNL  399 (499)
Q Consensus       371 ~gLPrl~~g~ilAHE~mHa~l~l~g~~~l  399 (499)
                      |+=.-+..-+|-|||..||-+.-+||.-|
T Consensus        82 y~~~SiaAvaVAAHEvGHAiQ~a~~Y~pl  110 (222)
T PF04298_consen   82 YNGRSIAAVAVAAHEVGHAIQHAEGYAPL  110 (222)
T ss_pred             CCCCCHHHHHHHHHHHhHHHhccccCcHH
Confidence            44455677799999999999999998543


No 61 
>PRK11827 hypothetical protein; Provisional
Probab=52.36  E-value=9.5  Score=30.36  Aligned_cols=18  Identities=28%  Similarity=0.499  Sum_probs=14.2

Q ss_pred             hcccccccccccccccHH
Q 010849          287 GMNMKLDQQIPMLLVERQ  304 (499)
Q Consensus       287 g~~m~~~~~~p~~lv~~~  304 (499)
                      ++.-+|..+||++|++..
T Consensus        33 ~laYPI~dgIPVlL~deA   50 (60)
T PRK11827         33 NLAFPLRDGIPVLLETEA   50 (60)
T ss_pred             CeeccccCCccccCHHHh
Confidence            456678999999999643


No 62 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=52.31  E-value=8.5  Score=29.47  Aligned_cols=30  Identities=23%  Similarity=0.787  Sum_probs=22.4

Q ss_pred             ccCCCCCccccCCceeEecCCccccchhhhhh
Q 010849          236 RCCSCERLESWNTRYYSLEDGRSLCLECMESA  267 (499)
Q Consensus       236 ~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sa  267 (499)
                      .|..|+.-..+-.+ +.+.|| .+|..|+..+
T Consensus         1 ~C~iCg~kigl~~~-~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKR-FKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccc-eeccCc-cchHHHHHHh
Confidence            47888885444333 678898 7999999887


No 63 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=51.62  E-value=9.8  Score=27.08  Aligned_cols=25  Identities=28%  Similarity=0.697  Sum_probs=19.8

Q ss_pred             cccCCCCCccccCCceeEecCCccccchhhh
Q 010849          235 SRCCSCERLESWNTRYYSLEDGRSLCLECME  265 (499)
Q Consensus       235 F~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~  265 (499)
                      +.|..|+.      .+|...||..||..|..
T Consensus         9 ~~C~~C~~------~~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    9 EPCPVCGS------RWFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CcCCCCCC------eEeEccCCEEEhhhCce
Confidence            45888875      26889999999999853


No 64 
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=51.24  E-value=8  Score=39.93  Aligned_cols=46  Identities=20%  Similarity=0.302  Sum_probs=36.4

Q ss_pred             CcccCCCCCCCCCCceEeeCCcccchhhhhhhc--cccccccCCccCCC
Q 010849          162 CFRCRSCGYPITEHEFSLSGKDPYHKSCFKELT--HPKCEVCHQYIPTN  208 (499)
Q Consensus       162 CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f--~pkC~~C~~~I~~~  208 (499)
                      =|.|..|.+++.. .....-+..+|..|..+.+  +++|.+|++.+.+.
T Consensus       241 Pf~c~icr~~f~~-pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g~  288 (313)
T KOG1813|consen  241 PFKCFICRKYFYR-PVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHGS  288 (313)
T ss_pred             Ccccccccccccc-chhhcCCceeehhhhccccccCCcceecccccccc
Confidence            4778888888765 4455578899999998876  57999999998874


No 65 
>PF02163 Peptidase_M50:  Peptidase family M50;  InterPro: IPR008915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry contains metallopeptidases belonging to MEROPS peptidase family M50 (S2P protease family, clan MM).  Members of the M50 metallopeptidase family include: mammalian sterol-regulatory element binding protein (SREBP) site 2 protease, Escherichia coli protease EcfE, stage IV sporulation protein FB and various hypothetical bacterial and eukaryotic homologues. A number of proteins are classified as non-peptidase homologues as they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3B4R_A 3ID4_A 3ID2_A 2ZPL_B 3ID1_A 2ZPM_A 3ID3_B 2HGA_A.
Probab=49.94  E-value=15  Score=34.73  Aligned_cols=20  Identities=35%  Similarity=0.293  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHHh-CC
Q 010849          377 LTGAILAHELMHGWLRLK-GY  396 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~l~-g~  396 (499)
                      +..+++.||++|++.... |.
T Consensus         6 ~~i~i~~HE~gH~~~a~~~G~   26 (192)
T PF02163_consen    6 LLISIVLHELGHALAARLYGD   26 (192)
T ss_dssp             HHHHHHHHHHHHHHHHHTTT-
T ss_pred             ccccccccccccccccccccc
Confidence            457899999999999875 53


No 66 
>PF01421 Reprolysin:  Reprolysin (M12B) family zinc metalloprotease  This Prosite motif covers only the active site.;  InterPro: IPR001590 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12B (adamalysin family, clan (MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The adamalysins are zinc dependent endopeptidases found in snake venom. There are some mammalian proteins such as P78325 from SWISSPROT, and fertilin Q28472 from SWISSPROT. Fertilin and closely related proteins appear to not have some active site residues and may not be active enzymes. CD156 (also called ADAM8 (3.4.24 from EC) or MS2 human) has been implicated in extravasation of leukocytes. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2E3X_A 2W15_A 2W14_A 2W13_A 2W12_A 1ND1_A 3K7L_A 2DW2_A 2DW0_B 2DW1_A ....
Probab=49.61  E-value=17  Score=34.59  Aligned_cols=24  Identities=33%  Similarity=0.304  Sum_probs=19.0

Q ss_pred             EEEEEcCCchhHHHHHHHHHHHHH
Q 010849          366 AILVLYGLPRLLTGAILAHELMHG  389 (499)
Q Consensus       366 ~Ilvl~gLPrl~~g~ilAHE~mHa  389 (499)
                      +|....+..-+.++.++|||++|.
T Consensus       119 ~i~~~~~~~~~~~a~~~AHelGH~  142 (199)
T PF01421_consen  119 GIVEDHSRSGLSFAVIIAHELGHN  142 (199)
T ss_dssp             EEEE-SSSSHHHHHHHHHHHHHHH
T ss_pred             cEeeeccchhHHHHHHHHHHHHHh
Confidence            566666677788999999999995


No 67 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=49.34  E-value=11  Score=31.93  Aligned_cols=30  Identities=20%  Similarity=0.466  Sum_probs=21.0

Q ss_pred             CCCCCCCCCCccCCCceEeec-CccccCCCc
Q 010849          134 SYKVCGGCNCDIGYGNYLGCM-GTYFHPNCF  163 (499)
Q Consensus       134 ~~~~C~~C~k~I~~g~~l~al-gk~wHp~CF  163 (499)
                      ....|..|+++|..+.++... |..+|..|+
T Consensus        77 ~~~~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   77 ESTKCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CCCCccCcCCcCCCceEEEeCCCeEEecccc
Confidence            356799999999766655544 455777775


No 68 
>KOG3931 consensus Uncharacterized conserved protein [Function unknown]
Probab=48.83  E-value=9.5  Score=40.28  Aligned_cols=22  Identities=32%  Similarity=0.452  Sum_probs=19.6

Q ss_pred             CchhHHHHHHHHHHHHHHHHHh
Q 010849          373 LPRLLTGAILAHELMHGWLRLK  394 (499)
Q Consensus       373 LPrl~~g~ilAHE~mHa~l~l~  394 (499)
                      -||--.--.|-|||.||||+..
T Consensus       100 RPRkDLVETLLHEMIHAYlFV~  121 (484)
T KOG3931|consen  100 RPRKDLVETLLHEMIHAYLFVT  121 (484)
T ss_pred             CchHHHHHHHHHHHHHHheeEe
Confidence            3888888999999999999984


No 69 
>PRK04860 hypothetical protein; Provisional
Probab=48.77  E-value=19  Score=34.00  Aligned_cols=28  Identities=21%  Similarity=0.299  Sum_probs=21.5

Q ss_pred             chhHHHHHHHHHHHHHHHHHh-C--CCCCChh
Q 010849          374 PRLLTGAILAHELMHGWLRLK-G--YRNLNPE  402 (499)
Q Consensus       374 Prl~~g~ilAHE~mHa~l~l~-g--~~~l~~~  402 (499)
                      +...+-.|++|||.|.++.+. |  ++. +.+
T Consensus        59 ~~~~l~~~v~HEl~H~~~~~~~g~~~~H-g~e   89 (160)
T PRK04860         59 QQAFIDEVVPHELAHLLVYQLFGRVAPH-GKE   89 (160)
T ss_pred             cHHHHHhHHHHHHHHHHHHHHcCCCCCC-CHH
Confidence            456668999999999999987 4  455 553


No 70 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=48.21  E-value=22  Score=26.34  Aligned_cols=42  Identities=24%  Similarity=0.474  Sum_probs=29.3

Q ss_pred             ccCCCCCCCCCCceEeeCCcc-cchhhhhhh--ccccccccCCccC
Q 010849          164 RCRSCGYPITEHEFSLSGKDP-YHKSCFKEL--THPKCEVCHQYIP  206 (499)
Q Consensus       164 ~C~~C~~~L~~~~F~~~dg~~-YC~~CY~~~--f~pkC~~C~~~I~  206 (499)
                      .|..|...... -.+..=+.. +|..|..+.  ...+|..|.++|.
T Consensus         4 ~C~iC~~~~~~-~~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~   48 (50)
T PF13920_consen    4 ECPICFENPRD-VVLLPCGHLCFCEECAERLLKRKKKCPICRQPIE   48 (50)
T ss_dssp             B-TTTSSSBSS-EEEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-S
T ss_pred             CCccCCccCCc-eEEeCCCChHHHHHHhHHhcccCCCCCcCChhhc
Confidence            46666666544 344556777 999999887  4788999999886


No 71 
>PF12773 DZR:  Double zinc ribbon
Probab=47.44  E-value=22  Score=26.32  Aligned_cols=11  Identities=27%  Similarity=0.570  Sum_probs=6.3

Q ss_pred             cccccCCccCC
Q 010849          197 KCEVCHQYIPT  207 (499)
Q Consensus       197 kC~~C~~~I~~  207 (499)
                      .|..|+..+..
T Consensus        31 ~C~~Cg~~~~~   41 (50)
T PF12773_consen   31 ICPNCGAENPP   41 (50)
T ss_pred             CCcCCcCCCcC
Confidence            46666665543


No 72 
>cd06158 S2P-M50_like_1 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with a minimal core protein and no PDZ domains.
Probab=46.14  E-value=18  Score=34.58  Aligned_cols=18  Identities=28%  Similarity=0.471  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 010849          377 LTGAILAHELMHGWLRLK  394 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~l~  394 (499)
                      +.-++..||++|||....
T Consensus         8 ~~~~i~~HE~aHa~~A~~   25 (181)
T cd06158           8 VLLAITLHEFAHAYVAYR   25 (181)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            455899999999999886


No 73 
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=45.84  E-value=10  Score=33.90  Aligned_cols=11  Identities=45%  Similarity=0.628  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHH
Q 010849          380 AILAHELMHGW  390 (499)
Q Consensus       380 ~ilAHE~mHa~  390 (499)
                      .+++||+|||-
T Consensus        88 ~~~~HEigHaL   98 (140)
T smart00235       88 GVAAHELGHAL   98 (140)
T ss_pred             ccHHHHHHHHh
Confidence            39999999993


No 74 
>PF10463 Peptidase_U49:  Peptidase U49;  InterPro: IPR019504 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported.  This entry contains peptidases belonging to MEROPS peptidase family U49 (Lit peptidase, clan U-). The Lit peptidase from Escherichia coli functions in bacterial cell death in response to infection by Enterobacteria phage T4. Following binding of Gol peptide to domains II and III of elongation factor Tu, the Lit peptidase cleaves domain I of the elongation factor. This prevents binding of guanine nucleotides, shuts down translation and leads to cell death. 
Probab=45.83  E-value=27  Score=34.37  Aligned_cols=50  Identities=26%  Similarity=0.112  Sum_probs=38.8

Q ss_pred             CCchhHHHHHHHHHHHHHHHHHhCC-CCCChhhhhhHHHHHHHHHhhcccC
Q 010849          372 GLPRLLTGAILAHELMHGWLRLKGY-RNLNPEVEEGICQVLSYMWLESEVL  421 (499)
Q Consensus       372 gLPrl~~g~ilAHE~mHa~l~l~g~-~~l~~~veEG~Cq~~a~~wl~~~~~  421 (499)
                      .|=-..++-||+||+.|+.+.--+. ..-...-||==|-..|-.||-+...
T Consensus        95 ~l~~~A~~fil~HE~~Hv~~~h~~~~~~~~~~~eE~~AD~~A~~~il~~~~  145 (206)
T PF10463_consen   95 DLFCCAIAFILLHELAHVVLGHEGDSSPSQSIQEEKEADSYATEMILSDVG  145 (206)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCccccccchhHHHHHhhhHHHHHHHHHHHH
Confidence            3445678899999999988888776 4455666777899999999866543


No 75 
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=45.16  E-value=13  Score=35.21  Aligned_cols=24  Identities=38%  Similarity=0.423  Sum_probs=17.2

Q ss_pred             EEEEEcCCchhHHHHHHHHHHHHHH
Q 010849          366 AILVLYGLPRLLTGAILAHELMHGW  390 (499)
Q Consensus       366 ~Ilvl~gLPrl~~g~ilAHE~mHa~  390 (499)
                      +|....+ +.+..+.++|||++|.+
T Consensus       122 ~v~~~~~-~~~~~~~~~aHElGH~l  145 (192)
T cd04267         122 GVVEDTG-FTLLTALTMAHELGHNL  145 (192)
T ss_pred             EEEecCC-cceeehhhhhhhHHhhc
Confidence            4444444 35678899999999975


No 76 
>TIGR02414 pepN_proteo aminopeptidase N, Escherichia coli type. The M1 family of zinc metallopeptidases contains a number of distinct, well-separated clades of proteins with aminopeptidase activity. Several are designated aminopeptidase N, EC 3.4.11.2, after the Escherichia coli enzyme, suggesting a similar activity profile. This family consists of all aminopeptidases closely related to E. coli PepN and presumed to have similar (not identical) function. Nearly all are found in Proteobacteria, but members are found also in Cyanobacteria, plants, and apicomplexan parasites. This family differs greatly in sequence from the family of aminopeptidases typified by Streptomyces lividans PepN (TIGR02412), from the membrane bound aminopeptidase N family in animals, etc.
Probab=44.54  E-value=79  Score=37.64  Aligned_cols=36  Identities=25%  Similarity=0.519  Sum_probs=27.5

Q ss_pred             HHHHHHHHHHHHHHHHhCCCCC-------ChhhhhhHHHHHHHHHhhc
Q 010849          378 TGAILAHELMHGWLRLKGYRNL-------NPEVEEGICQVLSYMWLES  418 (499)
Q Consensus       378 ~g~ilAHE~mHa~l~l~g~~~l-------~~~veEG~Cq~~a~~wl~~  418 (499)
                      ..+|+|||+.|-|.   |  ||       +..+-||+.-++..+|.+.
T Consensus       283 i~~VIaHElaHqWf---G--NlVT~~~W~~LWLnEGfAty~e~~~~~~  325 (863)
T TIGR02414       283 IESVIAHEYFHNWT---G--NRVTCRDWFQLSLKEGLTVFRDQEFSAD  325 (863)
T ss_pred             HHHHHHHHHHHHHh---c--ceeeecchhhhhhhhhHHHHHHHHHHHH
Confidence            45899999999994   3  22       3457999999888777554


No 77 
>PF01863 DUF45:  Protein of unknown function DUF45;  InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C terminus being the most conserved region, containing three conserved histidines.
Probab=43.56  E-value=15  Score=35.02  Aligned_cols=25  Identities=24%  Similarity=0.165  Sum_probs=20.6

Q ss_pred             EEEEEcCCchhHHHHHHHHHHHHHH
Q 010849          366 AILVLYGLPRLLTGAILAHELMHGW  390 (499)
Q Consensus       366 ~Ilvl~gLPrl~~g~ilAHE~mHa~  390 (499)
                      ==+-|.-+|.-+.-+|++|||.|..
T Consensus       152 ln~~L~~~P~~~idYVvvHEL~Hl~  176 (205)
T PF01863_consen  152 LNWRLVMAPPEVIDYVVVHELCHLR  176 (205)
T ss_pred             eecccccCCccHHHHHHHHHHHHhc
Confidence            3345667999999999999999974


No 78 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=43.51  E-value=25  Score=27.96  Aligned_cols=28  Identities=25%  Similarity=0.516  Sum_probs=16.2

Q ss_pred             CCCCCCCCCccCCCceEeecCccccCCCcccCCCCCC
Q 010849          135 YKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYP  171 (499)
Q Consensus       135 ~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~  171 (499)
                      .+.|..|+..|...+.         ---|.|..|+..
T Consensus         7 ~~~CtSCg~~i~~~~~---------~~~F~CPnCG~~   34 (59)
T PRK14890          7 PPKCTSCGIEIAPREK---------AVKFLCPNCGEV   34 (59)
T ss_pred             CccccCCCCcccCCCc---------cCEeeCCCCCCe
Confidence            4567788877753321         112667777665


No 79 
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=43.02  E-value=13  Score=33.86  Aligned_cols=14  Identities=29%  Similarity=0.223  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHH
Q 010849          377 LTGAILAHELMHGW  390 (499)
Q Consensus       377 ~~g~ilAHE~mHa~  390 (499)
                      ..-.+++||++||-
T Consensus        93 ~~~~~~~HEiGHaL  106 (165)
T cd04268          93 RLRNTAEHELGHAL  106 (165)
T ss_pred             HHHHHHHHHHHHHh
Confidence            46799999999994


No 80 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=42.05  E-value=9.2  Score=37.41  Aligned_cols=45  Identities=16%  Similarity=0.266  Sum_probs=35.3

Q ss_pred             CcccCCCCCCCCCCceEeeCCcccchhhhhhhc--cccccccCCccCC
Q 010849          162 CFRCRSCGYPITEHEFSLSGKDPYHKSCFKELT--HPKCEVCHQYIPT  207 (499)
Q Consensus       162 CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f--~pkC~~C~~~I~~  207 (499)
                      =|.|..|.+.... .....-|..||..|+.+.+  ++.|.+|++.-.+
T Consensus       196 PF~C~iCKkdy~s-pvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G  242 (259)
T COG5152         196 PFLCGICKKDYES-PVVTECGHSFCSLCAIRKYQKGDECGVCGKATYG  242 (259)
T ss_pred             ceeehhchhhccc-hhhhhcchhHHHHHHHHHhccCCcceecchhhcc
Confidence            5788999887654 3444568899999998876  7899999987665


No 81 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=41.96  E-value=24  Score=29.81  Aligned_cols=28  Identities=32%  Similarity=0.694  Sum_probs=22.8

Q ss_pred             ccCCCCCCCCCCceEee-CCcccchhhhh
Q 010849          164 RCRSCGYPITEHEFSLS-GKDPYHKSCFK  191 (499)
Q Consensus       164 ~C~~C~~~L~~~~F~~~-dg~~YC~~CY~  191 (499)
                      .|..|+++|....|... +|..+|..|..
T Consensus        80 ~C~vC~k~l~~~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   80 KCSVCGKPLGNSVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CccCcCCcCCCceEEEeCCCeEEeccccc
Confidence            59999999998777654 77888888865


No 82 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=41.51  E-value=6.9  Score=32.22  Aligned_cols=18  Identities=28%  Similarity=0.604  Sum_probs=13.1

Q ss_pred             CCCCCCCCCCCCccCCCc
Q 010849          132 PRSYKVCGGCNCDIGYGN  149 (499)
Q Consensus       132 ~~~~~~C~~C~k~I~~g~  149 (499)
                      ..+...|.+|++.|..|.
T Consensus         4 ks~Ra~Ck~C~~~I~kg~   21 (82)
T PF00645_consen    4 KSGRAKCKGCKKKIAKGE   21 (82)
T ss_dssp             SSSTEBETTTSCBE-TTS
T ss_pred             CCCCccCcccCCcCCCCC
Confidence            345678999999997664


No 83 
>KOG3624 consensus M13 family peptidase [Amino acid transport and metabolism]
Probab=40.52  E-value=13  Score=42.47  Aligned_cols=15  Identities=40%  Similarity=0.687  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHH
Q 010849          377 LTGAILAHELMHGWL  391 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l  391 (499)
                      ..|.|||||++|++=
T Consensus       517 ~iG~vigHEl~H~FD  531 (687)
T KOG3624|consen  517 GIGFVIGHELTHGFD  531 (687)
T ss_pred             HHHHHHHHHHhhccc
Confidence            579999999999873


No 84 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=40.23  E-value=4.2  Score=35.29  Aligned_cols=49  Identities=22%  Similarity=0.478  Sum_probs=27.4

Q ss_pred             CCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccc
Q 010849          138 CGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYH  186 (499)
Q Consensus       138 C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC  186 (499)
                      |..|...+.+-.+....-..+++.+..|..|.+.|+-.++.....=|||
T Consensus        38 Cy~CHdel~~Hpf~p~~~~~~~~~~iiCGvC~~~LT~~EY~~~~~Cp~C   86 (105)
T COG4357          38 CYHCHDELEDHPFEPWGLQEFNPKAIICGVCRKLLTRAEYGMCGSCPYC   86 (105)
T ss_pred             HHHHHhHHhcCCCccCChhhcCCccEEhhhhhhhhhHHHHhhcCCCCCc
Confidence            5555555543344444445667777777777777765555544443333


No 85 
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=40.00  E-value=19  Score=32.79  Aligned_cols=16  Identities=31%  Similarity=0.306  Sum_probs=13.5

Q ss_pred             hhHHHHHHHHHHHHHH
Q 010849          375 RLLTGAILAHELMHGW  390 (499)
Q Consensus       375 rl~~g~ilAHE~mHa~  390 (499)
                      ...+..++|||++|+.
T Consensus        93 ~~~~~~~~~HElGH~L  108 (167)
T cd00203          93 TKEGAQTIAHELGHAL  108 (167)
T ss_pred             cccchhhHHHHHHHHh
Confidence            3467899999999985


No 86 
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=39.82  E-value=19  Score=32.42  Aligned_cols=17  Identities=18%  Similarity=0.075  Sum_probs=13.4

Q ss_pred             CchhHHHHHHHHHHHHH
Q 010849          373 LPRLLTGAILAHELMHG  389 (499)
Q Consensus       373 LPrl~~g~ilAHE~mHa  389 (499)
                      .+......|++||+.||
T Consensus       100 ~~~~~~~~v~~HEiGHa  116 (154)
T PF00413_consen  100 DSGNDLQSVAIHEIGHA  116 (154)
T ss_dssp             SSSEEHHHHHHHHHHHH
T ss_pred             hhhhhhhhhhhhccccc
Confidence            34445678999999999


No 87 
>PF04228 Zn_peptidase:  Putative neutral zinc metallopeptidase;  InterPro: IPR007343 Members of this family of bacterial proteins are described as hypothetical proteins or zinc metallopeptidases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=39.76  E-value=23  Score=36.64  Aligned_cols=21  Identities=33%  Similarity=0.376  Sum_probs=18.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHhC
Q 010849          375 RLLTGAILAHELMHGWLRLKG  395 (499)
Q Consensus       375 rl~~g~ilAHE~mHa~l~l~g  395 (499)
                      .+...+|||||+.|.-+.|.|
T Consensus       167 ~~a~ayVlAHEyGHHVQ~l~G  187 (292)
T PF04228_consen  167 DFAQAYVLAHEYGHHVQNLLG  187 (292)
T ss_pred             HHHHHHHHHHHHHHHHHHHhh
Confidence            456678999999999999987


No 88 
>KOG3714 consensus Meprin A metalloprotease [Posttranslational modification, protein turnover, chaperones]
Probab=39.66  E-value=14  Score=40.00  Aligned_cols=14  Identities=36%  Similarity=0.434  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHHH
Q 010849          380 AILAHELMHGWLRL  393 (499)
Q Consensus       380 ~ilAHE~mHa~l~l  393 (499)
                      .|.+||||||==..
T Consensus       161 G~i~HEl~HaLGf~  174 (411)
T KOG3714|consen  161 GTIVHELMHALGFW  174 (411)
T ss_pred             chhHHHHHHHhhhh
Confidence            57899999995443


No 89 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=39.60  E-value=18  Score=41.53  Aligned_cols=55  Identities=13%  Similarity=0.063  Sum_probs=26.5

Q ss_pred             eccccC-CCCeeeeeecccccccccee-EEEEEEEcCCch-hHHHHHHHHHHHHHHHHH
Q 010849          338 LRRPRI-GGNRLVGMRTQPQKLTRKCE-VTAILVLYGLPR-LLTGAILAHELMHGWLRL  393 (499)
Q Consensus       338 ~~~~~~-~~~~~~~~~~~~~~~~r~~~-v~~Ilvl~gLPr-l~~g~ilAHE~mHa~l~l  393 (499)
                      +..|.+ .+-+.+...++...+.++.+ -=.|+|.+ -|. -+..+++.|.+-..|-+.
T Consensus       501 L~~pDfRA~Er~~qll~qvagragr~~~~G~V~iq~-~p~~~~~~~l~~~d~~~F~~~E  558 (665)
T PRK14873        501 LGRQDLRAAEDTLRRWMAAAALVRPRADGGQVVVVA-ESSLPTVQALIRWDPVGHAERE  558 (665)
T ss_pred             hcCCCcChHHHHHHHHHHHHHhhcCCCCCCEEEEEe-CCCCHHHHHHHhCCHHHHHHHH
Confidence            344544 22244444444443333211 11234444 776 455667778777666443


No 90 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=38.84  E-value=30  Score=25.11  Aligned_cols=39  Identities=26%  Similarity=0.546  Sum_probs=25.6

Q ss_pred             cCCCCCCCCC--CceEeeCCcccchhhhhhhc--cccccccCC
Q 010849          165 CRSCGYPITE--HEFSLSGKDPYHKSCFKELT--HPKCEVCHQ  203 (499)
Q Consensus       165 C~~C~~~L~~--~~F~~~dg~~YC~~CY~~~f--~pkC~~C~~  203 (499)
                      |..|......  ..+...=+..+|..|..+..  ..+|..|++
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhcCCCCCCcCCCC
Confidence            5666666632  23444568899999998876  556666653


No 91 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=38.66  E-value=25  Score=24.08  Aligned_cols=40  Identities=20%  Similarity=0.455  Sum_probs=22.2

Q ss_pred             cCCCCCCCCCCceEeeCCcccchhhhhhhc---cccccccCCc
Q 010849          165 CRSCGYPITEHEFSLSGKDPYHKSCFKELT---HPKCEVCHQY  204 (499)
Q Consensus       165 C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f---~pkC~~C~~~  204 (499)
                      |..|...+........=+..||..|..+.+   ..+|..|+..
T Consensus         2 C~iC~~~~~~~~~~~~C~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162           2 CPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CCcCchhhhCceEecCCCChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            555655553222222356778888876543   3457666654


No 92 
>COG5504 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=38.32  E-value=39  Score=34.39  Aligned_cols=39  Identities=31%  Similarity=0.462  Sum_probs=27.3

Q ss_pred             HHHHHHHHHHHHHHHh------C-CCCCChhhhhhHHHHHHHHHhhc
Q 010849          379 GAILAHELMHGWLRLK------G-YRNLNPEVEEGICQVLSYMWLES  418 (499)
Q Consensus       379 g~ilAHE~mHa~l~l~------g-~~~l~~~veEG~Cq~~a~~wl~~  418 (499)
                      -|++|||+=|. -|+.      | ...|+.-|-||+.|-.++.=..+
T Consensus       141 ~aliaHE~HH~-~R~~~i~~~eg~vtLle~lV~EGLAE~av~E~~Gr  186 (280)
T COG5504         141 PALIAHEYHHN-CRLRYIDYGEGSVTLLEALVMEGLAEHAVFELFGR  186 (280)
T ss_pred             HHHHHHHHHhh-heecccccCCCceeHHHHHHHHHHHHHHHHHHhCc
Confidence            37899999996 2333      1 23468899999999876654433


No 93 
>PF14247 DUF4344:  Domain of unknown function (DUF4344)
Probab=38.25  E-value=51  Score=32.80  Aligned_cols=39  Identities=26%  Similarity=0.137  Sum_probs=27.9

Q ss_pred             HHHHHHHHHHHHHHHHHhCCCCCChhhhhhHHHHHHHHHhh
Q 010849          377 LTGAILAHELMHGWLRLKGYRNLNPEVEEGICQVLSYMWLE  417 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~l~g~~~l~~~veEG~Cq~~a~~wl~  417 (499)
                      -+-.||-||+.||.+-+.+.|.|=  -||----.+|-+.|-
T Consensus        91 ~~~~~l~HE~GHAlI~~~~lPv~G--rEEDaaD~lAa~~ll  129 (220)
T PF14247_consen   91 NVLFTLYHELGHALIDDLDLPVLG--REEDAADQLAALLLL  129 (220)
T ss_pred             HHHHHHHHHHHHHHHHHhcCCccc--chhhHHHHHHHHHHh
Confidence            456899999999999999877764  355555555544443


No 94 
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Probab=38.08  E-value=26  Score=35.69  Aligned_cols=27  Identities=37%  Similarity=0.598  Sum_probs=19.9

Q ss_pred             EcCCchhHHHHHHHHHHHHHHHHHh-CCC
Q 010849          370 LYGLPRLLTGAILAHELMHGWLRLK-GYR  397 (499)
Q Consensus       370 l~gLPrl~~g~ilAHE~mHa~l~l~-g~~  397 (499)
                      ++++. .++-+++.||++||+.... |.+
T Consensus       111 ~~~~i-aL~isv~iHElgHa~~Ar~~G~~  138 (263)
T cd06159         111 PYGII-ALVVGVVVHELSHGILARVEGIK  138 (263)
T ss_pred             HHHHH-HHHHHHHHHHHHHHHHHHHcCCE
Confidence            34443 3677899999999999886 543


No 95 
>cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of SREBPs from membranes of the endoplasmic reticulum (ER). These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. The first cleavage occurs at Site-1 within the ER lumen to generate an intermediate that is subsequently released from the membrane by cleavage at Site-2, which lies within the first transmembrane domain. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD family.  This group appears to be limited to eumetazoan proteins and contains one PDZ domain.
Probab=37.53  E-value=23  Score=36.42  Aligned_cols=18  Identities=28%  Similarity=0.340  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 010849          377 LTGAILAHELMHGWLRLK  394 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~l~  394 (499)
                      ++.+++.||++||+....
T Consensus       134 l~isvvvHElgHal~A~~  151 (277)
T cd06162         134 LLISGVVHEMGHGVAAVR  151 (277)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            577999999999999885


No 96 
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB.
Probab=36.95  E-value=32  Score=33.52  Aligned_cols=21  Identities=38%  Similarity=0.507  Sum_probs=17.9

Q ss_pred             hHHHHHHHHHHHHHHHHHh-CC
Q 010849          376 LLTGAILAHELMHGWLRLK-GY  396 (499)
Q Consensus       376 l~~g~ilAHE~mHa~l~l~-g~  396 (499)
                      .++.+++.||+.|++.... |.
T Consensus        36 ~l~~~v~iHElgH~~~A~~~G~   57 (208)
T cd06161          36 LLFLSVLLHELGHALVARRYGI   57 (208)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCC
Confidence            5788999999999998776 64


No 97 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=36.34  E-value=23  Score=30.43  Aligned_cols=36  Identities=19%  Similarity=0.583  Sum_probs=24.0

Q ss_pred             ccCCCCCCCCCCceEeeCCcccchhhhhhhccccccccCCccCC
Q 010849          164 RCRSCGYPITEHEFSLSGKDPYHKSCFKELTHPKCEVCHQYIPT  207 (499)
Q Consensus       164 ~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~pkC~~C~~~I~~  207 (499)
                      .|..|...+..      .+.-||..|..+  .-.|+.|++.|..
T Consensus        46 ~C~~CK~~v~q------~g~~YCq~CAYk--kGiCamCGKki~d   81 (90)
T PF10235_consen   46 KCKICKTKVHQ------PGAKYCQTCAYK--KGICAMCGKKILD   81 (90)
T ss_pred             ccccccccccc------CCCccChhhhcc--cCcccccCCeecc
Confidence            45555554432      356788888665  3589999999865


No 98 
>PHA00527 hypothetical protein
Probab=36.24  E-value=1.3e+02  Score=26.69  Aligned_cols=47  Identities=26%  Similarity=0.364  Sum_probs=31.9

Q ss_pred             EEEEEEEcCCchhHHHHHHHHHHHHHHHHH-h--CCCCCChhhhhhHHHHHHHHH
Q 010849          364 VTAILVLYGLPRLLTGAILAHELMHGWLRL-K--GYRNLNPEVEEGICQVLSYMW  415 (499)
Q Consensus       364 v~~Ilvl~gLPrl~~g~ilAHE~mHa~l~l-~--g~~~l~~~veEG~Cq~~a~~w  415 (499)
                      +.-|-|..|-     .+.||||+.|.=... .  |...=|-+.-|-.|-+|+-|.
T Consensus        64 L~~~GVFNGK-----~~T~~HECAH~AF~vC~~VGV~~E~G~ANETYCY~~~R~~  113 (129)
T PHA00527         64 LYLLGVFNGK-----AATLVHECAHVAFYVCRDVGVTTEPGDANETYCYMLDRMF  113 (129)
T ss_pred             EEEEEEeccH-----HHHHHHHHHHHHHHHHHhcCcccCCCccchhHHHHHHHHH
Confidence            3455566663     488999999965444 3  555556677788888887663


No 99 
>PRK09672 phage exclusion protein Lit; Provisional
Probab=35.89  E-value=50  Score=34.42  Aligned_cols=50  Identities=22%  Similarity=0.161  Sum_probs=39.0

Q ss_pred             cCCchhHHHHHHHHHHHHHHHHHhCCCCC-ChhhhhhHHHHHHHHHhhccc
Q 010849          371 YGLPRLLTGAILAHELMHGWLRLKGYRNL-NPEVEEGICQVLSYMWLESEV  420 (499)
Q Consensus       371 ~gLPrl~~g~ilAHE~mHa~l~l~g~~~l-~~~veEG~Cq~~a~~wl~~~~  420 (499)
                      .-|=-..++-|+.||+.|+.+-..++... +-.-||==|...|.-||-...
T Consensus       158 ndLfl~A~a~i~~HEiaHv~~~h~~~~~~e~s~~eE~eaDs~At~~il~~~  208 (305)
T PRK09672        158 NDLFLCALAWILLHEIAHVEFQHSSLESNEDSIQEEKEADSYATNWLLSKS  208 (305)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhccccccCchHHHHHHHHHHHHHHHHHHhcc
Confidence            34445788999999999999999886444 334567779999999997744


No 100
>PRK04023 DNA polymerase II large subunit; Validated
Probab=35.86  E-value=40  Score=40.37  Aligned_cols=52  Identities=21%  Similarity=0.379  Sum_probs=32.3

Q ss_pred             CCCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCCCCCceEeeCCcccchhhhhhhccccccccCCccCCC
Q 010849          134 SYKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPITEHEFSLSGKDPYHKSCFKELTHPKCEVCHQYIPTN  208 (499)
Q Consensus       134 ~~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~pkC~~C~~~I~~~  208 (499)
                      +.+.|..|+....               =|+|..|+..        .....+|..|-.......|..|+..+.+.
T Consensus       625 g~RfCpsCG~~t~---------------~frCP~CG~~--------Te~i~fCP~CG~~~~~y~CPKCG~El~~~  676 (1121)
T PRK04023        625 GRRKCPSCGKETF---------------YRRCPFCGTH--------TEPVYRCPRCGIEVEEDECEKCGREPTPY  676 (1121)
T ss_pred             cCccCCCCCCcCC---------------cccCCCCCCC--------CCcceeCccccCcCCCCcCCCCCCCCCcc
Confidence            3456777776531               1677777766        12234577776665566788888776654


No 101
>cd05709 S2P-M50 Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-bindin
Probab=35.86  E-value=26  Score=32.79  Aligned_cols=20  Identities=30%  Similarity=0.406  Sum_probs=15.9

Q ss_pred             HHHHHHHHHHHHHHHHHh-CC
Q 010849          377 LTGAILAHELMHGWLRLK-GY  396 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~l~-g~  396 (499)
                      ++.++..||++|++.... |.
T Consensus         7 ~~i~i~iHE~gH~~~A~~~G~   27 (180)
T cd05709           7 LLISVTVHELGHALVARRLGV   27 (180)
T ss_pred             HHHHHHHHHHHHHHHHHHcCC
Confidence            456899999999996654 65


No 102
>COG1451 Predicted metal-dependent hydrolase [General function prediction only]
Probab=35.77  E-value=21  Score=35.52  Aligned_cols=27  Identities=22%  Similarity=0.170  Sum_probs=22.0

Q ss_pred             EEEEEEEcCCchhHHHHHHHHHHHHHH
Q 010849          364 VTAILVLYGLPRLLTGAILAHELMHGW  390 (499)
Q Consensus       364 v~~Ilvl~gLPrl~~g~ilAHE~mHa~  390 (499)
                      ++==+.|-.+|.-+..+|++|||.|--
T Consensus       161 i~~~~~l~~~p~~~i~YVvvHELaHLk  187 (223)
T COG1451         161 IRFNWRLVMAPEEVIDYVVVHELAHLK  187 (223)
T ss_pred             EEeehhhhcCCHHHHHHHHHHHHHHHh
Confidence            334456778999999999999999953


No 103
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=35.27  E-value=22  Score=35.79  Aligned_cols=19  Identities=42%  Similarity=0.169  Sum_probs=15.8

Q ss_pred             CCchhHHHHHHHHHHHHHH
Q 010849          372 GLPRLLTGAILAHELMHGW  390 (499)
Q Consensus       372 gLPrl~~g~ilAHE~mHa~  390 (499)
                      -|.+.-..+|||||+.|.-
T Consensus       151 ~l~~dEl~aVlaHElgHi~  169 (302)
T COG0501         151 LLNDDELEAVLAHELGHIK  169 (302)
T ss_pred             hCCHHHHHHHHHHHHHHHh
Confidence            5677778899999999974


No 104
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family. This family consists of probable oligoendopeptidases in the M3 family, related to lactococcal PepF and group B streptococcal PepB (TIGR00181) but in a distinct clade with considerable sequence differences. The likely substrate is small peptides and not whole proteins, as with PepF, but members are not characterized and the activity profile may differ. Several bacteria have both a member of this family and a member of the PepF family.
Probab=35.21  E-value=46  Score=37.17  Aligned_cols=45  Identities=24%  Similarity=0.236  Sum_probs=29.2

Q ss_pred             hHHHHHHHHHHHHHHHHH--h-C----CCCCChhhhh---hHHHHHHHHHhhccc
Q 010849          376 LLTGAILAHELMHGWLRL--K-G----YRNLNPEVEE---GICQVLSYMWLESEV  420 (499)
Q Consensus       376 l~~g~ilAHE~mHa~l~l--~-g----~~~l~~~veE---G~Cq~~a~~wl~~~~  420 (499)
                      .---.+||||++||+--.  + +    +...+.++-|   =+++.+.+-||....
T Consensus       335 ~~dv~TL~HElGHa~H~~~s~~~~~~~~~~~~~~~aE~aS~~~E~l~~~~l~~~~  389 (549)
T TIGR02289       335 SGDIDVLTHEAGHAFHVYESRKDLLPEYRWPTYEAAELASMSMELLSMPWWDLFY  389 (549)
T ss_pred             hhHHHHHHHHhhHHHHHHHhcCCcccccccCcchhhhhhHHHHHHHHHHHHHHHc
Confidence            344578999999997432  2 2    2223455555   577888888877654


No 105
>PF13688 Reprolysin_5:  Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=34.92  E-value=25  Score=33.24  Aligned_cols=20  Identities=25%  Similarity=0.237  Sum_probs=14.5

Q ss_pred             chhHHHHHHHHHHHHHHHHH
Q 010849          374 PRLLTGAILAHELMHGWLRL  393 (499)
Q Consensus       374 Prl~~g~ilAHE~mHa~l~l  393 (499)
                      |-.....++|||+.|.+=-.
T Consensus       138 ~~~~~~~~~AHEiGH~lGa~  157 (196)
T PF13688_consen  138 PTYNGAITFAHEIGHNLGAP  157 (196)
T ss_dssp             -HHHHHHHHHHHHHHHTT--
T ss_pred             CCCceehhhHHhHHHhcCCC
Confidence            46777899999999987433


No 106
>cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed tha
Probab=34.69  E-value=33  Score=34.00  Aligned_cols=21  Identities=38%  Similarity=0.583  Sum_probs=17.8

Q ss_pred             hHHHHHHHHHHHHHHHHHh-CC
Q 010849          376 LLTGAILAHELMHGWLRLK-GY  396 (499)
Q Consensus       376 l~~g~ilAHE~mHa~l~l~-g~  396 (499)
                      .++.+++.||+.|++.... |+
T Consensus        51 ~l~~~v~iHElgH~~~A~~~G~   72 (227)
T cd06164          51 LLFASVLLHELGHSLVARRYGI   72 (227)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCC
Confidence            5789999999999998775 54


No 107
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=34.26  E-value=25  Score=22.51  Aligned_cols=9  Identities=33%  Similarity=1.058  Sum_probs=4.7

Q ss_pred             CCCCCCccC
Q 010849          138 CGGCNCDIG  146 (499)
Q Consensus       138 C~~C~k~I~  146 (499)
                      |..|+..|.
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            455555553


No 108
>PF05299 Peptidase_M61:  M61 glycyl aminopeptidase;  InterPro: IPR007963 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M61 (glycyl aminopeptidase family, clan MA(E)).The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example is glycyl aminopeptidase from Sphingomonas capsulata.
Probab=33.57  E-value=14  Score=33.43  Aligned_cols=41  Identities=27%  Similarity=0.380  Sum_probs=29.4

Q ss_pred             HHHHHHHHHHHHHH--HHhC--C-------CCC--ChhhhhhHHHHHHHHHhhc
Q 010849          378 TGAILAHELMHGWL--RLKG--Y-------RNL--NPEVEEGICQVLSYMWLES  418 (499)
Q Consensus       378 ~g~ilAHE~mHa~l--~l~g--~-------~~l--~~~veEG~Cq~~a~~wl~~  418 (499)
                      +-.++|||+-|+|-  |++.  .       |+.  -+.|-||+=+.++.+-|-+
T Consensus         4 ~l~l~sHEffH~WnvkrirP~~l~p~dy~~~~~t~~LWv~EG~T~Y~~~l~l~R   57 (122)
T PF05299_consen    4 FLGLLSHEFFHSWNVKRIRPAELGPFDYEKPNYTELLWVYEGFTSYYGDLLLVR   57 (122)
T ss_pred             hhhhhhhhccccccceEeccccccCCCCCCCCCCCCEeeeeCcHHHHHHHHHHH
Confidence            45789999999997  3332  1       111  2478899999999886655


No 109
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily. BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
Probab=33.54  E-value=22  Score=34.80  Aligned_cols=11  Identities=45%  Similarity=0.528  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHH
Q 010849          380 AILAHELMHGW  390 (499)
Q Consensus       380 ~ilAHE~mHa~  390 (499)
                      .+++||||||-
T Consensus        89 Gti~HEl~HaL   99 (200)
T cd04281          89 GIVVHELGHVI   99 (200)
T ss_pred             chHHHHHHHHh
Confidence            48999999995


No 110
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=32.66  E-value=29  Score=26.54  Aligned_cols=29  Identities=31%  Similarity=0.657  Sum_probs=21.0

Q ss_pred             ccCCCCCCCCCC-ceEeeCCcccchhhhhhh
Q 010849          164 RCRSCGYPITEH-EFSLSGKDPYHKSCFKEL  193 (499)
Q Consensus       164 ~C~~C~~~L~~~-~F~~~dg~~YC~~CY~~~  193 (499)
                      .|..|+..++-- .+-..|| ..|.+|+.+.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            377788777643 3666777 6899999885


No 111
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=32.45  E-value=24  Score=32.37  Aligned_cols=28  Identities=21%  Similarity=0.558  Sum_probs=20.4

Q ss_pred             cCCCCCccccCCceeEecCCccccchhhhhhccCC
Q 010849          237 CCSCERLESWNTRYYSLEDGRSLCLECMESAIMDT  271 (499)
Q Consensus       237 C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sav~dt  271 (499)
                      |..|+.++      |. +||..||+.|-...+..+
T Consensus        31 Cp~Cg~PL------F~-KdG~v~CPvC~~~~~~v~   58 (131)
T COG1645          31 CPKCGTPL------FR-KDGEVFCPVCGYREVVVE   58 (131)
T ss_pred             CcccCCcc------ee-eCCeEECCCCCceEEEee
Confidence            77888843      55 899999999975544433


No 112
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=32.37  E-value=26  Score=32.03  Aligned_cols=16  Identities=38%  Similarity=0.235  Sum_probs=13.2

Q ss_pred             hhHHHHHHHHHHHHHH
Q 010849          375 RLLTGAILAHELMHGW  390 (499)
Q Consensus       375 rl~~g~ilAHE~mHa~  390 (499)
                      ..-+-+|+.||++||-
T Consensus       101 ~~~~~~~~~HEiGHaL  116 (156)
T cd04279         101 AENLQAIALHELGHAL  116 (156)
T ss_pred             chHHHHHHHHHhhhhh
Confidence            4567899999999983


No 113
>KOG2199 consensus Signal transducing adaptor protein STAM/STAM2 [Signal transduction mechanisms]
Probab=32.27  E-value=22  Score=38.32  Aligned_cols=25  Identities=36%  Similarity=0.533  Sum_probs=21.7

Q ss_pred             chhhhhhhHHHHHHhcchhhhcCcC
Q 010849           73 RADREKEELDHAIALSLAEDLKRPN   97 (499)
Q Consensus        73 ~~~~e~edid~ai~~sL~Ee~kk~~   97 (499)
                      .+.+|.|||..||++||.|.++.++
T Consensus       161 ~~k~EeEdiaKAi~lSL~E~~~Q~k  185 (462)
T KOG2199|consen  161 SSKQEEEDIAKAIELSLKEQEKQKK  185 (462)
T ss_pred             cccccHHHHHHHHHhhHHHHhhchh
Confidence            3568999999999999999988755


No 114
>COG0308 PepN Aminopeptidase N [Amino acid transport and metabolism]
Probab=32.13  E-value=55  Score=38.81  Aligned_cols=115  Identities=22%  Similarity=0.297  Sum_probs=65.7

Q ss_pred             HHHHHHHHHHHHHHHhCCCCC----ChhhhhhHHHHHHHHHhhcccC------CC---CCCC-C----CCCCC------C
Q 010849          379 GAILAHELMHGWLRLKGYRNL----NPEVEEGICQVLSYMWLESEVL------PD---YRNM-P----STSSA------S  434 (499)
Q Consensus       379 g~ilAHE~mHa~l~l~g~~~l----~~~veEG~Cq~~a~~wl~~~~~------~~---~~~~-~----~~~~~------~  434 (499)
                      .++.||||.|.|.-=  ...+    +..+-||+--++.+.|.+....      ..   .++. +    +..++      .
T Consensus       308 ~~viaHElaHqWfGn--lVT~~~W~~lWLnEgfat~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~hPi~~~~  385 (859)
T COG0308         308 EEVIAHELAHQWFGN--LVTMKWWDDLWLNEGFATFREVLWSEDLGGRAWKRWEDFRTLRTSIALAEDSLPSSHPIRVDV  385 (859)
T ss_pred             HHHHHHHHhhhcccc--eeeccCHHHHHHhhhhHHHHHHHHHHHhcchHHHHHHHHHHHhhhHHHhhccccccCCcccCC
Confidence            449999999999421  0111    3778899999999999887542      00   0000 0    00000      0


Q ss_pred             ---------CCCCCCCCCC-----------chHHHHHHHHHHHhhhhcCCCCCchhhHHHHHHHHHHhCHHHHHHHHHhh
Q 010849          435 ---------TSSSSSKKGG-----------KSEVEKKLGEFFMHQIAHDASPAYGEGFRIANAAVNKYGLRRTLEHIRLT  494 (499)
Q Consensus       435 ---------~~~~~~~~g~-----------~~~~e~~l~~~~~~qi~~d~s~vYGdGfR~~~~a~~~~gl~~~l~~i~~~  494 (499)
                               .+.++=.||.           ...|-+-|..||..   .+-..+.++=|..+.+.+...-|..+++.-...
T Consensus       386 ~~~~ei~~~fD~i~Y~KGs~vlrml~~~lG~e~F~kgl~~yf~~---h~~~~~~~~Dl~~a~~~~sg~dl~~~~~~w~~q  462 (859)
T COG0308         386 YDPKEINDFFDAIVYEKGASVLRMLETLLGEEAFRKGLSLYFKR---HAGGNATTMDLWKALEDASGKDLSAFFESWLSQ  462 (859)
T ss_pred             CCccchhhhcchhhcchhHHHHHHHHHHHCHHHHHHHHHHHHHh---cCCCCCCHHHHHHHHHHHhCCcHHHHHHHHHhC
Confidence                     0000112222           44566677777766   445556677777777777766677666666555


Q ss_pred             CCCC
Q 010849          495 GNFP  498 (499)
Q Consensus       495 g~~p  498 (499)
                      .-+|
T Consensus       463 ~G~P  466 (859)
T COG0308         463 AGYP  466 (859)
T ss_pred             CCCC
Confidence            5555


No 115
>PF05572 Peptidase_M43:  Pregnancy-associated plasma protein-A;  InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase M43 (cytophagalysin family, clan MA(M)), subfamily M43. The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example of this family is the pregnancy-associated plasma protein A (PAPP-A), which cleaves insulin-like growth factor (IGF) binding protein-4 (IGFBP-4), causing a dramatic reduction in its affinity for IGF-I and -II. Through this mechanism, PAPP-A is a regulator of IGF bioactivity in several systems, including the Homo sapiens ovary and the cardiovascular system [, , , ].; PDB: 3LUN_A 3LUM_B 2J83_A 2CKI_A.
Probab=31.67  E-value=27  Score=32.58  Aligned_cols=20  Identities=40%  Similarity=0.665  Sum_probs=13.6

Q ss_pred             chhHHHHHHHHHHHHHHHHHh
Q 010849          374 PRLLTGAILAHELMHGWLRLK  394 (499)
Q Consensus       374 Prl~~g~ilAHE~mHa~l~l~  394 (499)
                      +..-.|.+|+||++| ||-|.
T Consensus        65 ~~~~~g~TltHEvGH-~LGL~   84 (154)
T PF05572_consen   65 SQYNFGKTLTHEVGH-WLGLY   84 (154)
T ss_dssp             TTS-SSHHHHHHHHH-HTT--
T ss_pred             Cccccccchhhhhhh-hhccc
Confidence            356668999999999 55553


No 116
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only]
Probab=31.65  E-value=33  Score=36.32  Aligned_cols=16  Identities=25%  Similarity=0.470  Sum_probs=12.8

Q ss_pred             CCcCCCCcccCCCCCc
Q 010849          228 SHEHDHTSRCCSCERL  243 (499)
Q Consensus       228 ~H~H~~CF~C~~C~r~  243 (499)
                      +|+-+.||+|--|+++
T Consensus        73 ~~y~~qSftCPyC~~~   88 (381)
T KOG1280|consen   73 SHYDPQSFTCPYCGIM   88 (381)
T ss_pred             cccccccccCCccccc
Confidence            3556779999999985


No 117
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=31.64  E-value=38  Score=24.64  Aligned_cols=32  Identities=44%  Similarity=0.684  Sum_probs=21.2

Q ss_pred             ccCCCCCccccCCceeEecCCccccchhhhhh
Q 010849          236 RCCSCERLESWNTRYYSLEDGRSLCLECMESA  267 (499)
Q Consensus       236 ~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sa  267 (499)
                      +|+-|++.....+..+.-.++-.+|..|.+.+
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~~~   34 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECVEQA   34 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHHHHH
Confidence            58899997766666665555789999998665


No 118
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=31.56  E-value=40  Score=38.68  Aligned_cols=37  Identities=24%  Similarity=0.671  Sum_probs=30.4

Q ss_pred             ccCCCCCCCCCCceEeeCCcccchhhhhhhccccccccCCccCC
Q 010849          164 RCRSCGYPITEHEFSLSGKDPYHKSCFKELTHPKCEVCHQYIPT  207 (499)
Q Consensus       164 ~C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~pkC~~C~~~I~~  207 (499)
                      .|..|+...       .++..||..|-..+-...|..|+..++.
T Consensus         3 ~Cp~Cg~~n-------~~~akFC~~CG~~l~~~~Cp~CG~~~~~   39 (645)
T PRK14559          3 ICPQCQFEN-------PNNNRFCQKCGTSLTHKPCPQCGTEVPV   39 (645)
T ss_pred             cCCCCCCcC-------CCCCccccccCCCCCCCcCCCCCCCCCc
Confidence            577887664       4699999999888877889999998876


No 119
>PF13574 Reprolysin_2:  Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A ....
Probab=31.55  E-value=28  Score=32.87  Aligned_cols=18  Identities=28%  Similarity=0.108  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHhC
Q 010849          378 TGAILAHELMHGWLRLKG  395 (499)
Q Consensus       378 ~g~ilAHE~mHa~l~l~g  395 (499)
                      ...++|||+.|.+=.-+.
T Consensus       111 ~~~~~aHElGH~lGa~Hd  128 (173)
T PF13574_consen  111 GIDTFAHELGHQLGAPHD  128 (173)
T ss_dssp             HHHHHHHHHHHHHT---S
T ss_pred             eeeeehhhhHhhcCCCCC
Confidence            567899999999855553


No 120
>cd06461 M2_ACE Peptidase family M2 Angiotensin converting enzyme (ACE, EC 3.4.15.1) is a membrane-bound, zinc dependent dipeptidase that catalyzes the conversion of the decapeptide angiotensin I to the potent vasopressor ocatapeptide angiotensin II, by removing two C-terminal amino acids. There are two forms of the enzyme in humans, the ubiquitous somatic ACE and the sperm-specific germinal ACE, both encoded by the same gene through transcription from alternative promoters. Somatic ACE has two tandem active sites with distinct catalytic properties, whereas germinal ACE, the function of which is largely unknown, has just a single active site. Recently, an ACE homolog, ACE2, has been identified in humans that differs from ACE; it preferentially removes carboxy-terminal hydrophobic or basic amino acids and appears to be important in cardiac function. ACE homologs (also known as members of the M2 gluzincin family) have been found in a wide variety of species, including those that neither h
Probab=31.52  E-value=50  Score=36.56  Aligned_cols=33  Identities=21%  Similarity=0.385  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHHhCCCCCC--------hhhhhhHHHHHHHH
Q 010849          381 ILAHELMHGWLRLKGYRNLN--------PEVEEGICQVLSYM  414 (499)
Q Consensus       381 ilAHE~mHa~l~l~g~~~l~--------~~veEG~Cq~~a~~  414 (499)
                      ++-|||.||+..+. |+++|        |-..|-+|+++|..
T Consensus       250 t~~HE~GH~~yy~~-y~~~p~~~r~~anp~fheav~e~~smS  290 (477)
T cd06461         250 TVHHEMGHIQYYLQ-YKDQPVLFREGANPGFHEAVGDAIALS  290 (477)
T ss_pred             HHHHHHHHHHHHHH-hccCCHHHhCCCCCChHHHHHHHHHHh
Confidence            46699999987766 55554        44455789888653


No 121
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=31.39  E-value=31  Score=33.13  Aligned_cols=16  Identities=19%  Similarity=0.102  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q 010849          377 LTGAILAHELMHGWLR  392 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~  392 (499)
                      .+..++.||+|||-=.
T Consensus        91 ~~~~~i~HElgHaLG~  106 (198)
T cd04327          91 EFSRVVLHEFGHALGF  106 (198)
T ss_pred             hHHHHHHHHHHHHhcC
Confidence            4456999999999633


No 122
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=31.37  E-value=23  Score=25.55  Aligned_cols=22  Identities=14%  Similarity=0.184  Sum_probs=12.7

Q ss_pred             CCCCCCccCC-CceEeecCcccc
Q 010849          138 CGGCNCDIGY-GNYLGCMGTYFH  159 (499)
Q Consensus       138 C~~C~k~I~~-g~~l~algk~wH  159 (499)
                      |.-|+.+|.. ..++...++.||
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~   23 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYY   23 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEE
Confidence            5567777742 234556666666


No 123
>COG4784 Putative Zn-dependent protease [General function prediction only]
Probab=31.19  E-value=66  Score=34.30  Aligned_cols=107  Identities=23%  Similarity=0.288  Sum_probs=61.0

Q ss_pred             EEEEcCCchhH-----HHHHHHHHHHHHHHHHhCCCCCChhhhhhHHHHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCC
Q 010849          367 ILVLYGLPRLL-----TGAILAHELMHGWLRLKGYRNLNPEVEEGICQVLSYMWLESEVLPDYRNMPSTSSASTSSSSSK  441 (499)
Q Consensus       367 Ilvl~gLPrl~-----~g~ilAHE~mHa~l~l~g~~~l~~~veEG~Cq~~a~~wl~~~~~~~~~~~~~~~~~~~~~~~~~  441 (499)
                      |+|-.||=.++     ..++|||||.|+=-+- |...-..+-+|+|---+....|.+.... ..             ..-
T Consensus       108 lYitRGLlAland~sEvAAVl~HEmgHVtAnH-gi~rQ~~e~a~~ia~rvva~vl~~~~ag-k~-------------A~~  172 (479)
T COG4784         108 LYITRGLLALANDSSEVAAVLAHEMGHVTANH-GIQRQQREAAEVIASRVVAEVLGSDAAG-KQ-------------ALI  172 (479)
T ss_pred             EEEehhHHHHcCCHHHHHHHHHhhhhheecch-hHHHHHHHHHHHHHHHHHHHHhCCcchh-hH-------------HHh
Confidence            56666776554     5789999999975432 3444566777777544444434333211 00             000


Q ss_pred             CCCchHHHHHHHHHHHhhhhcCCCCCchhhHHHHHHH-HHHhCHHHHHHHHHhhCCC
Q 010849          442 KGGKSEVEKKLGEFFMHQIAHDASPAYGEGFRIANAA-VNKYGLRRTLEHIRLTGNF  497 (499)
Q Consensus       442 ~g~~~~~e~~l~~~~~~qi~~d~s~vYGdGfR~~~~a-~~~~gl~~~l~~i~~~g~~  497 (499)
                      .|+     .+|+.|=++ +|--.|   +-|-|..-+| |+-|-..++|+.+..+-.|
T Consensus       173 rGk-----lrla~fsRn-qELqAD---~iG~~~lgeAGYDP~A~~rfl~sm~ay~~F  220 (479)
T COG4784         173 RGK-----LRLAQFSRN-QELQAD---AIGIKMLGEAGYDPYAAARFLQSMAAYTDF  220 (479)
T ss_pred             hhh-----HHHhhhccc-hhhhhh---hhhHHHHHhcCCChHHHHHHHHHHHhhhhh
Confidence            121     255555444 343333   4566665554 7777788888888777666


No 124
>COG2738 Predicted Zn-dependent protease [General function prediction only]
Probab=30.77  E-value=28  Score=34.18  Aligned_cols=28  Identities=29%  Similarity=0.309  Sum_probs=23.4

Q ss_pred             EcCCchhHHHHHHHHHHHHHHHHHhCCC
Q 010849          370 LYGLPRLLTGAILAHELMHGWLRLKGYR  397 (499)
Q Consensus       370 l~gLPrl~~g~ilAHE~mHa~l~l~g~~  397 (499)
                      -|+=|.+...++.|||..||.+-..+|+
T Consensus        84 ~y~g~Sia~~aVAAHEVGHAiQd~~~Y~  111 (226)
T COG2738          84 NYYGPSIAAIAVAAHEVGHAIQDQEDYA  111 (226)
T ss_pred             ccCCccHHHHHHHHHHhhHHHhhhcccH
Confidence            3677889999999999999987777653


No 125
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=30.32  E-value=48  Score=32.37  Aligned_cols=30  Identities=13%  Similarity=0.317  Sum_probs=19.2

Q ss_pred             CcccCCCCCCCCCCceEeeCCcccchhhhhh
Q 010849          162 CFRCRSCGYPITEHEFSLSGKDPYHKSCFKE  192 (499)
Q Consensus       162 CF~C~~C~~~L~~~~F~~~dg~~YC~~CY~~  192 (499)
                      .|.|..|...+.+ .....-+..||..|..+
T Consensus        18 ~~~CpICld~~~d-PVvT~CGH~FC~~CI~~   47 (193)
T PLN03208         18 DFDCNICLDQVRD-PVVTLCGHLFCWPCIHK   47 (193)
T ss_pred             ccCCccCCCcCCC-cEEcCCCchhHHHHHHH
Confidence            4667777666544 34445677888888754


No 126
>PF10391 DNA_pol_lambd_f:  Fingers domain of DNA polymerase lambda;  InterPro: IPR018944  DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains. There is a general polymerase fold consisting of three subdomains that have been likened to the fingers, palm, and thumb of a right hand. This entry represents the central three-helical region of DNA polymerase lambda referred to as the F and G helices of the fingers domain. Contacts with DNA involve this conserved helix-hairpin-helix motif in the fingers region which interacts with the primer strand. This motif is common to several DNA binding proteins and confers a sequence-independent interaction with the DNA backbone []. ; GO: 0016779 nucleotidyltransferase activity; PDB: 1KDH_A 1KEJ_A 1JMS_A 2IHM_A 3OGU_A 1MQ2_A 2P66_A 7ICI_A 1ZQN_A 1ZQK_A ....
Probab=30.26  E-value=53  Score=25.23  Aligned_cols=27  Identities=33%  Similarity=0.470  Sum_probs=18.4

Q ss_pred             CCchhhHHHHHHHHHHhCHHHHHHHHHhh
Q 010849          466 PAYGEGFRIANAAVNKYGLRRTLEHIRLT  494 (499)
Q Consensus       466 ~vYGdGfR~~~~a~~~~gl~~~l~~i~~~  494 (499)
                      .|||-|-..|.+-++ .|++ +|+.|+..
T Consensus         6 ~I~GVG~~tA~~w~~-~G~r-tl~Dl~~~   32 (52)
T PF10391_consen    6 GIWGVGPKTARKWYA-KGIR-TLEDLRKS   32 (52)
T ss_dssp             TSTT--HHHHHHHHH-TT---SHHHHHHG
T ss_pred             hcccccHHHHHHHHH-hCCC-CHHHHhhh
Confidence            499999999999998 7875 56666653


No 127
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily. Meprins are membrane-bound or secreted extracellular proteases, which cleave a variety of targets, including peptides such as parathyroid hormone, gastrin, and cholecystokinin, cytokines such as osteopontin, and proteins such as collagen IV, fibronectin, casein and gelatin. Meprins may also be able to release proteins from the cell surface. Closely related meprin alpha- and beta-subunits form homo- and hetero-oligomers; these complexes are found on epithelial cells of the intestine, for example, and are also expressed in certain cancer cells.
Probab=30.24  E-value=26  Score=35.06  Aligned_cols=12  Identities=33%  Similarity=0.631  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHH
Q 010849          379 GAILAHELMHGW  390 (499)
Q Consensus       379 g~ilAHE~mHa~  390 (499)
                      -.+++||||||-
T Consensus       121 ~Gti~HEl~Hal  132 (230)
T cd04282         121 KATVEHEFLHAL  132 (230)
T ss_pred             CchHHHHHHHHh
Confidence            368999999995


No 128
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=29.87  E-value=26  Score=32.39  Aligned_cols=36  Identities=25%  Similarity=0.646  Sum_probs=27.2

Q ss_pred             ccCCCCCccccCCceeEecCCccccchhhhhhccCCCCCCchhhhHHHHHh
Q 010849          236 RCCSCERLESWNTRYYSLEDGRSLCLECMESAIMDTGDCQPLYHAIRDYYE  286 (499)
Q Consensus       236 ~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sav~dt~e~qpl~~~i~~f~~  286 (499)
                      .|..|+++|.       . .++.+|+.|++..       ...|..|.+|.+
T Consensus         5 nC~~CgklF~-------~-~~~~iCp~C~~~~-------e~~f~kV~~yLr   40 (137)
T TIGR03826         5 NCPKCGRLFV-------K-TGRDVCPSCYEEE-------EREFEKVYKFLR   40 (137)
T ss_pred             cccccchhhh-------h-cCCccCHHHhHHH-------HHHHHHHHHHHH
Confidence            4888888653       2 2688999999776       456888889875


No 129
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=29.84  E-value=21  Score=35.00  Aligned_cols=18  Identities=17%  Similarity=0.278  Sum_probs=12.9

Q ss_pred             ceEeeCCcccchhhhhhh
Q 010849          176 EFSLSGKDPYHKSCFKEL  193 (499)
Q Consensus       176 ~F~~~dg~~YC~~CY~~~  193 (499)
                      .-...+|++.|+.||.+.
T Consensus       186 ~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         186 RAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             hhhhcCCceecccccccc
Confidence            334567888999998753


No 130
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=29.75  E-value=52  Score=31.13  Aligned_cols=16  Identities=44%  Similarity=0.513  Sum_probs=13.6

Q ss_pred             hhHHHHHHHHHHHHHH
Q 010849          375 RLLTGAILAHELMHGW  390 (499)
Q Consensus       375 rl~~g~ilAHE~mHa~  390 (499)
                      -+.+..++|||++|.+
T Consensus       128 ~~~~a~~~AHElGH~l  143 (194)
T cd04269         128 LLLFAVTMAHELGHNL  143 (194)
T ss_pred             hHHHHHHHHHHHHhhc
Confidence            3677899999999976


No 131
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.
Probab=29.73  E-value=50  Score=31.74  Aligned_cols=22  Identities=23%  Similarity=0.243  Sum_probs=17.5

Q ss_pred             hHHHHHHHHHHHHHHHHHh-CCC
Q 010849          376 LLTGAILAHELMHGWLRLK-GYR  397 (499)
Q Consensus       376 l~~g~ilAHE~mHa~l~l~-g~~  397 (499)
                      .++.+++.||++|+|.... |.+
T Consensus        39 ~l~~~l~iHElgH~~~A~~~G~~   61 (183)
T cd06160          39 ALLAILGIHEMGHYLAARRHGVK   61 (183)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCC
Confidence            3567889999999999876 654


No 132
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=29.68  E-value=10  Score=26.55  Aligned_cols=28  Identities=25%  Similarity=0.566  Sum_probs=15.9

Q ss_pred             cCCCCCCCCCCceEeeCCcccchhhhhh
Q 010849          165 CRSCGYPITEHEFSLSGKDPYHKSCFKE  192 (499)
Q Consensus       165 C~~C~~~L~~~~F~~~dg~~YC~~CY~~  192 (499)
                      |..|+.+|.........+..+|..|..+
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~C~~~   33 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVECQER   33 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HHHHHH
T ss_pred             ccccCChHHHHHHHhCCCcEECHHHhCc
Confidence            5566666655444455667777777654


No 133
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=29.42  E-value=40  Score=26.91  Aligned_cols=16  Identities=25%  Similarity=0.555  Sum_probs=12.4

Q ss_pred             cccccccccccccccH
Q 010849          288 MNMKLDQQIPMLLVER  303 (499)
Q Consensus       288 ~~m~~~~~~p~~lv~~  303 (499)
                      +.-+|..+||++|.+.
T Consensus        34 ~aYpI~dGIPvlL~~e   49 (60)
T COG2835          34 LAYPIRDGIPVLLPDE   49 (60)
T ss_pred             ceeecccCccccCchh
Confidence            3457889999999853


No 134
>PRK00420 hypothetical protein; Validated
Probab=29.29  E-value=28  Score=31.14  Aligned_cols=30  Identities=23%  Similarity=0.528  Sum_probs=22.2

Q ss_pred             cCCCCCccccCCceeEecCCccccchhhhhhccCCC
Q 010849          237 CCSCERLESWNTRYYSLEDGRSLCLECMESAIMDTG  272 (499)
Q Consensus       237 C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sav~dt~  272 (499)
                      |..|+.  |    .|.+.+|+.+|+.|-...+....
T Consensus        26 CP~Cg~--p----Lf~lk~g~~~Cp~Cg~~~~v~~~   55 (112)
T PRK00420         26 CPVCGL--P----LFELKDGEVVCPVHGKVYIVKSD   55 (112)
T ss_pred             CCCCCC--c----ceecCCCceECCCCCCeeeeccH
Confidence            666776  3    36678999999999887665443


No 135
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=28.84  E-value=29  Score=31.85  Aligned_cols=21  Identities=24%  Similarity=0.648  Sum_probs=14.6

Q ss_pred             cCCCCCCCCCCceEeeCCcccchhhh
Q 010849          165 CRSCGYPITEHEFSLSGKDPYHKSCF  190 (499)
Q Consensus       165 C~~C~~~L~~~~F~~~dg~~YC~~CY  190 (499)
                      |..|+.||     |.++|.+||.-|-
T Consensus        31 Cp~Cg~PL-----F~KdG~v~CPvC~   51 (131)
T COG1645          31 CPKCGTPL-----FRKDGEVFCPVCG   51 (131)
T ss_pred             CcccCCcc-----eeeCCeEECCCCC
Confidence            66777776     3388888886653


No 136
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=28.69  E-value=18  Score=31.60  Aligned_cols=30  Identities=23%  Similarity=0.618  Sum_probs=21.1

Q ss_pred             CcccCCCCCccccCCceeEecCCccccchhh
Q 010849          234 TSRCCSCERLESWNTRYYSLEDGRSLCLECM  264 (499)
Q Consensus       234 CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~  264 (499)
                      =|+|.+|--+- ...+.....+|+++|..|.
T Consensus        70 EFTCssCFLV~-HRSqLa~~~~g~~iC~DCa   99 (99)
T PF13834_consen   70 EFTCSSCFLVH-HRSQLAREKDGQPICRDCA   99 (99)
T ss_pred             ceeeeeeeeEe-chhhhccccCCCEeccccC
Confidence            38999997543 2334445678999999993


No 137
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=28.68  E-value=51  Score=26.33  Aligned_cols=29  Identities=31%  Similarity=0.588  Sum_probs=17.1

Q ss_pred             CCCCCCCCCccCCCceEeecCccccCCCcccCCCCCCC
Q 010849          135 YKVCGGCNCDIGYGNYLGCMGTYFHPNCFRCRSCGYPI  172 (499)
Q Consensus       135 ~~~C~~C~k~I~~g~~l~algk~wHp~CF~C~~C~~~L  172 (499)
                      .+.|..|+..|..++-..         -|.|..|+..+
T Consensus         9 ~~~CtSCg~~i~p~e~~v---------~F~CPnCGe~~   37 (61)
T COG2888           9 PPVCTSCGREIAPGETAV---------KFPCPNCGEVE   37 (61)
T ss_pred             CceeccCCCEeccCCcee---------EeeCCCCCcee
Confidence            467888888884443211         26677776443


No 138
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily. Hatching enzymes are secreted by teleost embryos to digest the egg envelope or chorion. In some teleosts, the hatching enzyme may be a system consisting of two evolutionary related  metalloproteases, high choriolytic enzyme and low choriolytic enzyme (HCE and LCE), which may have different  substrate specificities and cooperatively digest the chorion.
Probab=28.27  E-value=31  Score=33.24  Aligned_cols=12  Identities=42%  Similarity=0.783  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHH
Q 010849          379 GAILAHELMHGW  390 (499)
Q Consensus       379 g~ilAHE~mHa~  390 (499)
                      -.+++||+|||-
T Consensus        78 ~G~i~HEl~HaL   89 (182)
T cd04283          78 KGIIQHELLHAL   89 (182)
T ss_pred             cchHHHHHHHHh
Confidence            368999999994


No 139
>KOG3314 consensus Ku70-binding protein [Replication, recombination and repair]
Probab=27.98  E-value=35  Score=32.63  Aligned_cols=20  Identities=20%  Similarity=0.385  Sum_probs=16.1

Q ss_pred             hhHHHHHHHHHHHHHHHHHh
Q 010849          375 RLLTGAILAHELMHGWLRLK  394 (499)
Q Consensus       375 rl~~g~ilAHE~mHa~l~l~  394 (499)
                      ......+++|||.|||=-++
T Consensus        88 q~h~n~vv~HElIH~fDd~r  107 (194)
T KOG3314|consen   88 QDHVNQVVIHELIHAFDDCR  107 (194)
T ss_pred             HHHHHHHHHHHHHHHHHhhh
Confidence            34567899999999997765


No 140
>TIGR00181 pepF oligoendopeptidase F. This family represents the oligoendopeptidase F clade of the family of larger M3 or thimet (for thiol-dependent metallopeptidase) oligopeptidase family. Lactococcus lactis PepF hydrolyzed peptides of 7 and 17 amino acids with fairly broad specificity. The homolog of lactococcal PepF in group B Streptococcus was named PepB (PubMed:8757883), with the name difference reflecting a difference in species of origin rather activity; substrate profiles were quite similar. Differences in substrate specificity should be expected in other species. The gene is duplicated in Lactococcus lactis on the plasmid that bears it. A shortened second copy is found in Bacillus subtilis.
Probab=27.64  E-value=30  Score=38.82  Aligned_cols=17  Identities=41%  Similarity=0.317  Sum_probs=13.4

Q ss_pred             hhHHHHHHHHHHHHHHH
Q 010849          375 RLLTGAILAHELMHGWL  391 (499)
Q Consensus       375 rl~~g~ilAHE~mHa~l  391 (499)
                      .+---.+|||||+||+-
T Consensus       375 ~~~dv~TLaHElGHa~H  391 (591)
T TIGR00181       375 TLNSVFTLAHELGHSMH  391 (591)
T ss_pred             CcchHHHHHHHhhhHHH
Confidence            44556899999999983


No 141
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=27.60  E-value=37  Score=33.05  Aligned_cols=15  Identities=27%  Similarity=0.224  Sum_probs=12.4

Q ss_pred             hHHHHHHHHHHHHHH
Q 010849          376 LLTGAILAHELMHGW  390 (499)
Q Consensus       376 l~~g~ilAHE~mHa~  390 (499)
                      .....++|||++|..
T Consensus       143 ~~~~~~~AHElGH~l  157 (220)
T cd04272         143 YYGVYTMTHELAHLL  157 (220)
T ss_pred             cccHHHHHHHHHHHh
Confidence            455799999999975


No 142
>PF01400 Astacin:  Astacin (Peptidase family M12A) This Prosite motif covers only the active site.;  InterPro: IPR001506 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12A (astacin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The astacin () family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ....
Probab=27.32  E-value=36  Score=32.70  Aligned_cols=13  Identities=31%  Similarity=0.401  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHH
Q 010849          378 TGAILAHELMHGW  390 (499)
Q Consensus       378 ~g~ilAHE~mHa~  390 (499)
                      ...+++||+|||-
T Consensus        79 ~~~~i~HEl~HaL   91 (191)
T PF01400_consen   79 SVGTILHELGHAL   91 (191)
T ss_dssp             SHHHHHHHHHHHH
T ss_pred             CccchHHHHHHHH
Confidence            4568999999995


No 143
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]
Probab=27.02  E-value=36  Score=37.48  Aligned_cols=18  Identities=28%  Similarity=0.230  Sum_probs=14.0

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 010849          376 LLTGAILAHELMHGWLRL  393 (499)
Q Consensus       376 l~~g~ilAHE~mHa~l~l  393 (499)
                      --..+|||||..|.=.|-
T Consensus       128 sElagViAHEigHv~qrH  145 (484)
T COG4783         128 SELAGVIAHEIGHVAQRH  145 (484)
T ss_pred             HHHHHHHHHHHHHHhhhh
Confidence            445699999999986654


No 144
>PRK14873 primosome assembly protein PriA; Provisional
Probab=26.74  E-value=38  Score=39.04  Aligned_cols=58  Identities=14%  Similarity=0.308  Sum_probs=31.2

Q ss_pred             CcccCCCCCccccCCceeEecCCccccchhhhhhccCC-CCCCchhhhHHHHHhhcccccccccccccccHHHHHHHH
Q 010849          234 TSRCCSCERLESWNTRYYSLEDGRSLCLECMESAIMDT-GDCQPLYHAIRDYYEGMNMKLDQQIPMLLVERQALNEAI  310 (499)
Q Consensus       234 CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sav~dt-~e~qpl~~~i~~f~~g~~m~~~~~~p~~lv~~~~ln~a~  310 (499)
                      -.+|..|+...           ....|+.|-...+... ...+.+..++.+.|-        +.|++.++++.+-+..
T Consensus       410 ~l~Ch~CG~~~-----------~p~~Cp~Cgs~~l~~~g~Gter~eeeL~~~FP--------~~~V~r~d~d~~l~~~  468 (665)
T PRK14873        410 TPRCRWCGRAA-----------PDWRCPRCGSDRLRAVVVGARRTAEELGRAFP--------GVPVVTSGGDQVVDTV  468 (665)
T ss_pred             eeECCCCcCCC-----------cCccCCCCcCCcceeeeccHHHHHHHHHHHCC--------CCCEEEEChHHHHHhh
Confidence            46677777521           1235777766543322 234555555555542        4566777777643333


No 145
>PF13583 Reprolysin_4:  Metallo-peptidase family M12B Reprolysin-like
Probab=26.48  E-value=34  Score=33.28  Aligned_cols=15  Identities=27%  Similarity=0.224  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHh
Q 010849          380 AILAHELMHGWLRLK  394 (499)
Q Consensus       380 ~ilAHE~mHa~l~l~  394 (499)
                      .++|||++|++=--+
T Consensus       139 ~~~aHEiGH~lGl~H  153 (206)
T PF13583_consen  139 QTFAHEIGHNLGLRH  153 (206)
T ss_pred             hHHHHHHHHHhcCCC
Confidence            679999999975444


No 146
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only]
Probab=26.47  E-value=43  Score=33.67  Aligned_cols=34  Identities=21%  Similarity=0.546  Sum_probs=27.8

Q ss_pred             CCceEee-CCcccchhhhhhhccccccccCCccCC
Q 010849          174 EHEFSLS-GKDPYHKSCFKELTHPKCEVCHQYIPT  207 (499)
Q Consensus       174 ~~~F~~~-dg~~YC~~CY~~~f~pkC~~C~~~I~~  207 (499)
                      ...|+.. -..++|..|...-+++.|..|++.|..
T Consensus        15 ~~~f~LTaC~HvfC~~C~k~~~~~~C~lCkk~ir~   49 (233)
T KOG4739|consen   15 QDPFFLTACRHVFCEPCLKASSPDVCPLCKKSIRI   49 (233)
T ss_pred             CCceeeeechhhhhhhhcccCCccccccccceeee
Confidence            4456654 679999999988888899999999775


No 147
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=26.32  E-value=44  Score=24.57  Aligned_cols=21  Identities=29%  Similarity=0.766  Sum_probs=14.1

Q ss_pred             cCCCCCccccCCceeEecCCccccchh
Q 010849          237 CCSCERLESWNTRYYSLEDGRSLCLEC  263 (499)
Q Consensus       237 C~~C~r~~~~g~~~~~l~dGr~~C~~C  263 (499)
                      |..|+.++      +...+|+.+|..|
T Consensus        20 Cp~C~~PL------~~~k~g~~~Cv~C   40 (41)
T PF06677_consen   20 CPDCGTPL------MRDKDGKIYCVSC   40 (41)
T ss_pred             cCCCCCee------EEecCCCEECCCC
Confidence            45566632      4457888999887


No 148
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=25.96  E-value=70  Score=25.01  Aligned_cols=12  Identities=17%  Similarity=0.213  Sum_probs=8.4

Q ss_pred             CCCCCCCCCccC
Q 010849          135 YKVCGGCNCDIG  146 (499)
Q Consensus       135 ~~~C~~C~k~I~  146 (499)
                      ..+|..|+++|.
T Consensus         5 ~~~C~~Cg~~~~   16 (54)
T PF14446_consen    5 GCKCPVCGKKFK   16 (54)
T ss_pred             CccChhhCCccc
Confidence            356777777774


No 149
>PF08219 TOM13:  Outer membrane protein TOM13;  InterPro: IPR013262 The TOM13 family of proteins are mitochondrial outer membrane proteins that mediate the assembly of beta-barrel proteins [].; GO: 0005741 mitochondrial outer membrane
Probab=25.93  E-value=47  Score=27.72  Aligned_cols=23  Identities=26%  Similarity=0.264  Sum_probs=17.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHhCCCC
Q 010849          375 RLLTGAILAHELMHGWLRLKGYRN  398 (499)
Q Consensus       375 rl~~g~ilAHE~mHa~l~l~g~~~  398 (499)
                      .|=||-|+|||+.+-|=| .|++-
T Consensus        49 MLGFGEl~AhE~~fr~gW-~g~ki   71 (77)
T PF08219_consen   49 MLGFGELFAHEIAFRLGW-SGTKI   71 (77)
T ss_pred             hHhHHHHHHHHHHHHhcc-Cccee
Confidence            577999999999887754 45543


No 150
>COG1381 RecO Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=25.91  E-value=64  Score=32.45  Aligned_cols=31  Identities=26%  Similarity=0.684  Sum_probs=24.8

Q ss_pred             CCCcccCCCCCccccCCceeEecCCccccchhh
Q 010849          232 DHTSRCCSCERLESWNTRYYSLEDGRSLCLECM  264 (499)
Q Consensus       232 ~~CF~C~~C~r~~~~g~~~~~l~dGr~~C~~C~  264 (499)
                      ++=..|+.|++  +.+..+|....|..+|..|.
T Consensus       152 ~~l~~Ca~cg~--~~~~~~~s~~~~~~~C~~~~  182 (251)
T COG1381         152 PNLTSCARCGT--PVDPVYFSPKSGGFLCSKCA  182 (251)
T ss_pred             cchHHHhCcCC--cCCCcceeeccCcccchhcc
Confidence            33456999999  55556788888999999998


No 151
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the PepF Bacillus amyloliquefaciens oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over expressed from a multicopy plasmid.
Probab=25.11  E-value=74  Score=33.67  Aligned_cols=38  Identities=24%  Similarity=0.142  Sum_probs=21.1

Q ss_pred             hHHHHHHHHHHHHHHHHHh---CCCCCChhhhhhHHHHHHH
Q 010849          376 LLTGAILAHELMHGWLRLK---GYRNLNPEVEEGICQVLSY  413 (499)
Q Consensus       376 l~~g~ilAHE~mHa~l~l~---g~~~l~~~veEG~Cq~~a~  413 (499)
                      .---..|+||++||+--+.   ..+.+...+.-.+.++.|-
T Consensus       220 ~~~v~tl~HE~GHa~h~~~~~~~~~~~~~~~~~~~~E~~S~  260 (427)
T cd06459         220 LDDVFTLAHELGHAFHSYLSRDNQPYLYSDYPIFLAEIAST  260 (427)
T ss_pred             hhhHHHHHHHhhHHHHHHHHccCCCcccCCCCchhhHHHHH
Confidence            4445789999999864442   2232433344445554443


No 152
>PF07607 DUF1570:  Protein of unknown function (DUF1570);  InterPro: IPR011464 This entry represents hypothetical proteins confined to bacteria.
Probab=24.97  E-value=80  Score=28.78  Aligned_cols=33  Identities=27%  Similarity=0.297  Sum_probs=25.9

Q ss_pred             HHHHHHHHHHHHHHhCC-CC---CChhhhhhHHHHHH
Q 010849          380 AILAHELMHGWLRLKGY-RN---LNPEVEEGICQVLS  412 (499)
Q Consensus       380 ~ilAHE~mHa~l~l~g~-~~---l~~~veEG~Cq~~a  412 (499)
                      +.++||..|-=+.-.|. ++   -|..|-|||-..+.
T Consensus         3 ~T~~HEa~HQl~~N~Gl~~r~~~~P~Wv~EGlA~yFE   39 (128)
T PF07607_consen    3 ATIAHEATHQLAFNTGLHPRLADWPRWVSEGLATYFE   39 (128)
T ss_pred             hHHHHHHHHHHHHHccccccCCCCchHHHHhHHHHcC
Confidence            68999999998887784 33   47889999876653


No 153
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=24.86  E-value=34  Score=28.69  Aligned_cols=29  Identities=28%  Similarity=0.707  Sum_probs=19.1

Q ss_pred             ccCCCCCCCCCCceEee-----CCcccchhhhhh
Q 010849          164 RCRSCGYPITEHEFSLS-----GKDPYHKSCFKE  192 (499)
Q Consensus       164 ~C~~C~~~L~~~~F~~~-----dg~~YC~~CY~~  192 (499)
                      .|..|+-||.....+..     .+.-||.-||..
T Consensus         2 ~CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    2 FCQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             cCCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            47788888875542222     236789999876


No 154
>PF13582 Reprolysin_3:  Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C.
Probab=24.76  E-value=37  Score=29.44  Aligned_cols=12  Identities=33%  Similarity=0.412  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHH
Q 010849          379 GAILAHELMHGW  390 (499)
Q Consensus       379 g~ilAHE~mHa~  390 (499)
                      ..++|||+.|.+
T Consensus       108 ~~~~~HEiGH~l  119 (124)
T PF13582_consen  108 VDTFAHEIGHNL  119 (124)
T ss_dssp             TTHHHHHHHHHT
T ss_pred             ceEeeehhhHhc
Confidence            389999999974


No 155
>PF01432 Peptidase_M3:  Peptidase family M3 This Prosite motif covers only the active site. This family belongs to family M3 of the peptidase classification.;  InterPro: IPR001567 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M3 (clan MA(E)), subfamilies M3A and M3B. The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. The Thimet oligopeptidase family, is a large family of archaeal, bacterial and eukaryotic oligopeptidases that cleave medium sized peptides. The group contains:  mitochondrial intermediate peptidase (3.4.24.59 from EC) Neurolysin, mitochondrial precursor, (3.4.24.16 from EC) Thimet oligopeptidase (3.4.24.15 from EC) Dipeptidyl carboxypeptidase (3.4.15.5 from EC) Oligopeptidase A (3.4.24.70 from EC) Oligoendopeptidase F ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QR4_B 3CE2_A 1Y79_1 2H1J_A 2H1N_A 2O36_A 1S4B_P 2O3E_A 1I1I_P.
Probab=24.66  E-value=1.5e+02  Score=31.96  Aligned_cols=18  Identities=28%  Similarity=0.135  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 010849          377 LTGAILAHELMHGWLRLK  394 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~l~  394 (499)
                      ---.+|+||++||+--+-
T Consensus       241 ~~v~tLfHE~GHa~H~~l  258 (458)
T PF01432_consen  241 DDVETLFHEFGHAMHSLL  258 (458)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHhHHHHHHH
Confidence            356899999999998774


No 156
>cd06163 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses. Also included in this group are such homologs as Bacillus subtilis YluC, Mycobacterium tuberculosis Rv2869c S2P, and Bordetella bronchiseptica HurP.  Rv2869c S2P appears to have a role in the regulation of prokaryotic lipid biosynthesis and membrane composition and YluC of Bacillus has a role in transducing membrane stress. This group includes bacterial and eukaryotic S2P/M50s homologs with either one or two PDZ domains present. PDZ domains are believed to have a regulatory role. The RseP PDZ domain is required for the inhibitory reaction that prevents cleavage of its substrate, RseA.
Probab=23.30  E-value=59  Score=31.25  Aligned_cols=21  Identities=33%  Similarity=0.284  Sum_probs=16.7

Q ss_pred             hHHHHHHHHHHHHHHHHHh-CC
Q 010849          376 LLTGAILAHELMHGWLRLK-GY  396 (499)
Q Consensus       376 l~~g~ilAHE~mHa~l~l~-g~  396 (499)
                      .+..+|+-||+.|+|.... |.
T Consensus         7 ~l~~~v~iHElGH~~~Ar~~Gv   28 (182)
T cd06163           7 VLGILIFVHELGHFLVAKLFGV   28 (182)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCC
Confidence            3567899999999998765 54


No 157
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]
Probab=23.18  E-value=39  Score=35.35  Aligned_cols=42  Identities=19%  Similarity=0.544  Sum_probs=24.1

Q ss_pred             cCCCCCCCCCCceEeeCCcccchhhhhhhccccccccCCccC
Q 010849          165 CRSCGYPITEHEFSLSGKDPYHKSCFKELTHPKCEVCHQYIP  206 (499)
Q Consensus       165 C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f~pkC~~C~~~I~  206 (499)
                      |..|+.+|.-..-..--+..||.+|...---+.|..|...|.
T Consensus        93 Cd~Cd~PI~IYGRmIPCkHvFCl~CAr~~~dK~Cp~C~d~Vq  134 (389)
T KOG2932|consen   93 CDRCDFPIAIYGRMIPCKHVFCLECARSDSDKICPLCDDRVQ  134 (389)
T ss_pred             ecccCCcceeeecccccchhhhhhhhhcCccccCcCcccHHH
Confidence            455555554332233345666777765544557888887764


No 158
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=23.06  E-value=90  Score=38.45  Aligned_cols=51  Identities=16%  Similarity=0.197  Sum_probs=27.9

Q ss_pred             cccCCCCCccccCCceeEecCCccccchhhhhhccCCCCCCchhhhHHHHHhhcccc
Q 010849          235 SRCCSCERLESWNTRYYSLEDGRSLCLECMESAIMDTGDCQPLYHAIRDYYEGMNMK  291 (499)
Q Consensus       235 F~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sav~dt~e~qpl~~~i~~f~~g~~m~  291 (499)
                      +.|..|+...+.+.      .+...|+.|-..++..+..--++-....+=.+.+|+.
T Consensus       693 y~CPsCGaev~~de------s~a~~CP~CGtplv~~~~~~i~~~~~~~~A~~~~g~~  743 (1337)
T PRK14714        693 YVCPDCGAEVPPDE------SGRVECPRCDVELTPYQRRTINVKEEYRSALENVGER  743 (1337)
T ss_pred             eeCccCCCccCCCc------cccccCCCCCCcccccceEEecHHHHHHHHHHHhCcc
Confidence            45777777433221      1245688887777665544444444444445555555


No 159
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=22.79  E-value=40  Score=30.89  Aligned_cols=19  Identities=32%  Similarity=0.237  Sum_probs=14.6

Q ss_pred             chhHHHHHHHHHHHHHHHHH
Q 010849          374 PRLLTGAILAHELMHGWLRL  393 (499)
Q Consensus       374 Prl~~g~ilAHE~mHa~l~l  393 (499)
                      +..-+-+|+.||+.|| |-|
T Consensus       103 ~~~~~~~~~~HEiGHa-LGL  121 (157)
T cd04278         103 GGTDLFSVAAHEIGHA-LGL  121 (157)
T ss_pred             ccchHHHHHHHHhccc-ccc
Confidence            4456778999999999 444


No 160
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=22.70  E-value=69  Score=23.54  Aligned_cols=11  Identities=18%  Similarity=0.416  Sum_probs=6.9

Q ss_pred             Ccccchhhhhh
Q 010849          182 KDPYHKSCFKE  192 (499)
Q Consensus       182 g~~YC~~CY~~  192 (499)
                      +--+|..||..
T Consensus        22 d~dLC~~Cf~~   32 (46)
T cd02249          22 DFDLCSSCYAK   32 (46)
T ss_pred             CCcCHHHHHCc
Confidence            34567777765


No 161
>PF13203 DUF2201_N:  Putative metallopeptidase domain
Probab=22.65  E-value=57  Score=33.08  Aligned_cols=23  Identities=30%  Similarity=0.328  Sum_probs=18.6

Q ss_pred             cCCchhHHHHHHHHHHHHHHHHH
Q 010849          371 YGLPRLLTGAILAHELMHGWLRL  393 (499)
Q Consensus       371 ~gLPrl~~g~ilAHE~mHa~l~l  393 (499)
                      .+|+.--...+|+||+||.-++-
T Consensus        53 ~~l~~~~~~~~l~HevlH~~~~H   75 (292)
T PF13203_consen   53 ESLSPEERVGLLLHEVLHCLLRH   75 (292)
T ss_pred             hcCCHHHHHHHHHHHHHHHHccc
Confidence            56677777889999999987765


No 162
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=22.58  E-value=53  Score=21.39  Aligned_cols=9  Identities=33%  Similarity=1.091  Sum_probs=4.9

Q ss_pred             CCCCCCCcc
Q 010849          137 VCGGCNCDI  145 (499)
Q Consensus       137 ~C~~C~k~I  145 (499)
                      .|..|+..|
T Consensus         4 ~Cp~Cg~~~   12 (26)
T PF13248_consen    4 FCPNCGAEI   12 (26)
T ss_pred             CCcccCCcC
Confidence            455555554


No 163
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=22.51  E-value=36  Score=33.51  Aligned_cols=31  Identities=26%  Similarity=0.591  Sum_probs=23.3

Q ss_pred             cccCCCCCccccCCceeEecCCccccchhhhhh
Q 010849          235 SRCCSCERLESWNTRYYSLEDGRSLCLECMESA  267 (499)
Q Consensus       235 F~C~~C~r~~~~g~~~~~l~dGr~~C~~C~~sa  267 (499)
                      -+|..|+-++.  .....+.+|+++|..|+...
T Consensus       173 v~C~kCGE~~~--e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFM--EPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccc--cchhhhcCCceecccccccc
Confidence            57999998553  33456778999999998743


No 164
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=22.51  E-value=60  Score=22.73  Aligned_cols=37  Identities=24%  Similarity=0.627  Sum_probs=21.3

Q ss_pred             cCCCCCCCCCCceEeeCCcccchhhhhhhc--ccccccc
Q 010849          165 CRSCGYPITEHEFSLSGKDPYHKSCFKELT--HPKCEVC  201 (499)
Q Consensus       165 C~~C~~~L~~~~F~~~dg~~YC~~CY~~~f--~pkC~~C  201 (499)
                      |..|...+.+.-....=|..||..|..+..  .++|..|
T Consensus         1 C~iC~~~~~~~~~~~~CGH~fC~~C~~~~~~~~~~CP~C   39 (39)
T PF13923_consen    1 CPICLDELRDPVVVTPCGHSFCKECIEKYLEKNPKCPVC   39 (39)
T ss_dssp             ETTTTSB-SSEEEECTTSEEEEHHHHHHHHHCTSB-TTT
T ss_pred             CCCCCCcccCcCEECCCCCchhHHHHHHHHHCcCCCcCC
Confidence            455666665532455678899999987643  3444443


No 165
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=22.36  E-value=43  Score=31.79  Aligned_cols=10  Identities=50%  Similarity=0.906  Sum_probs=9.3

Q ss_pred             HHHHHHHHHH
Q 010849          380 AILAHELMHG  389 (499)
Q Consensus       380 ~ilAHE~mHa  389 (499)
                      .++.||+|||
T Consensus        76 g~v~HE~~Ha   85 (180)
T cd04280          76 GTIVHELMHA   85 (180)
T ss_pred             chhHHHHHHH
Confidence            6889999999


No 166
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=22.07  E-value=61  Score=35.96  Aligned_cols=27  Identities=11%  Similarity=0.012  Sum_probs=15.9

Q ss_pred             EEEEcCCch-hHHHHHHHHHHHHHHHHH
Q 010849          367 ILVLYGLPR-LLTGAILAHELMHGWLRL  393 (499)
Q Consensus       367 Ilvl~gLPr-l~~g~ilAHE~mHa~l~l  393 (499)
                      ++|...-|. .+.-+.+.|.+-..|-+.
T Consensus       374 viiqt~~p~~~~~~~~~~~d~~~f~~~e  401 (505)
T TIGR00595       374 VIIQTYNPNHPAIQAALTGDYEAFYEQE  401 (505)
T ss_pred             EEEEeCCCCCHHHHHHHhCCHHHHHHHH
Confidence            344555565 345566677777777443


No 167
>KOG1046 consensus Puromycin-sensitive aminopeptidase and related aminopeptidases [Amino acid transport and metabolism; Posttranslational modification, protein turnover, chaperones]
Probab=21.79  E-value=1.7e+02  Score=34.89  Aligned_cols=39  Identities=28%  Similarity=0.606  Sum_probs=31.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHhCCCCC-------ChhhhhhHHHHHHHHHhhc
Q 010849          375 RLLTGAILAHELMHGWLRLKGYRNL-------NPEVEEGICQVLSYMWLES  418 (499)
Q Consensus       375 rl~~g~ilAHE~mHa~l~l~g~~~l-------~~~veEG~Cq~~a~~wl~~  418 (499)
                      +.....++|||+.|-|.     .||       +..+-|||-.+|++.=++.
T Consensus       321 k~~va~vIaHElAHQWF-----GNLVTm~wW~dLWLnEGfAt~~~~~~v~~  366 (882)
T KOG1046|consen  321 KQRVAEVIAHELAHQWF-----GNLVTMKWWNDLWLNEGFATYVEYLAVDH  366 (882)
T ss_pred             HHHHHHHHHHHHHHHHh-----cCcccHhhhhhhhhcccHHHHHHHHhhcc
Confidence            45677899999999995     344       3567899999999987773


No 168
>PF09471 Peptidase_M64:  IgA Peptidase M64;  InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of highly selective metallo-endopeptidases belonging to the MEROPS peptidase family M64 (IgA peptidase, clan MA). The primary structure of the Clostridium ramosum IgA peptidase shows no significant overall similarity to any other known metallo-endopeptidase []. ; PDB: 3P1V_A 4DF9_D.
Probab=21.27  E-value=50  Score=33.72  Aligned_cols=19  Identities=21%  Similarity=0.279  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHHHHhC
Q 010849          377 LTGAILAHELMHGWLRLKG  395 (499)
Q Consensus       377 ~~g~ilAHE~mHa~l~l~g  395 (499)
                      .+..|+.||+.|.+..|..
T Consensus       215 ~~~~v~vHE~GHsf~~LaD  233 (264)
T PF09471_consen  215 SFKQVVVHEFGHSFGGLAD  233 (264)
T ss_dssp             THHHHHHHHHHHHTT----
T ss_pred             cccceeeeecccccccccc
Confidence            6899999999999999974


No 169
>cd06258 Peptidase_M3_like The peptidase M3-like family, also called neurolysin-like family, is part of the "zincins" metallopeptidases, and includes M3, M2 and M32 families of metallopeptidases.  The M3 family is subdivided into two subfamilies: the widespread M3A, which comprises a number of high-molecular mass endo- and exopeptidases from bacteria, archaea, protozoa, fungi, plants and animals, and the small M3B, whose members are enzymes primarily from bacteria. Well-known mammalian/eukaryotic M3A endopeptidases are the thimet oligopeptidase (TOP; endopeptidase 3.4.24.15), neurolysin (alias endopeptidase 3.4.24.16), and the mitochondrial intermediate peptidase. The first two are intracellular oligopeptidases, which act only on relatively short substrates of less than 20 amino acid residues, while the latter cleaves N-terminal octapeptides from proteins during their import into the mitochondria. The M3A subfamily also contains several bacterial endopeptidases, collectively called olig
Probab=21.21  E-value=1.5e+02  Score=30.78  Aligned_cols=37  Identities=22%  Similarity=0.093  Sum_probs=21.9

Q ss_pred             hHHHHHHHHHHHHHHHHHh---CCCC-----CChhhhhhHHHHHH
Q 010849          376 LLTGAILAHELMHGWLRLK---GYRN-----LNPEVEEGICQVLS  412 (499)
Q Consensus       376 l~~g~ilAHE~mHa~l~l~---g~~~-----l~~~veEG~Cq~~a  412 (499)
                      .---.+|+||++||.--+.   .++.     .+.++-|-.-+++-
T Consensus       152 ~~~v~tl~HE~GHa~h~~l~~~~~~~~~g~~~~~~~~E~~S~~~E  196 (365)
T cd06258         152 HDDINTLFHEFGHAVHFLLIQQRYPFQERTPTSTDFAEAQSMFLE  196 (365)
T ss_pred             HHHHHHHHHHHhHHHHHHHhcCCCCcCCCCCCCccHHhccHHHHH
Confidence            3344679999999995553   2332     35555555545443


No 170
>PRK04439 S-adenosylmethionine synthetase; Provisional
Probab=20.96  E-value=86  Score=33.90  Aligned_cols=22  Identities=41%  Similarity=0.591  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHHhCCCCCChh
Q 010849          380 AILAHELMHGWLRLKGYRNLNPE  402 (499)
Q Consensus       380 ~ilAHE~mHa~l~l~g~~~l~~~  402 (499)
                      .-+|-|....||+-+ .|+|+++
T Consensus       104 ~~Ia~~Aak~~L~~~-l~~lD~e  125 (399)
T PRK04439        104 GEIAIEAAKEYLREN-LRNLDPE  125 (399)
T ss_pred             HHHHHHHHHHHHHHh-CccCCcc
Confidence            667899999999998 7888764


No 171
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=20.85  E-value=25  Score=30.89  Aligned_cols=28  Identities=29%  Similarity=0.428  Sum_probs=0.0

Q ss_pred             CCCCCCCccCCCceEeecCcc-ccCCCcc
Q 010849          137 VCGGCNCDIGYGNYLGCMGTY-FHPNCFR  164 (499)
Q Consensus       137 ~C~~C~k~I~~g~~l~algk~-wHp~CF~  164 (499)
                      .|.-|+++|..|+..++..+. -|-.||+
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~   32 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFR   32 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHH


No 172
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=20.69  E-value=46  Score=34.41  Aligned_cols=29  Identities=24%  Similarity=0.637  Sum_probs=13.9

Q ss_pred             CCCCCCccCCCceEeecCccccCCCcccC
Q 010849          138 CGGCNCDIGYGNYLGCMGTYFHPNCFRCR  166 (499)
Q Consensus       138 C~~C~k~I~~g~~l~algk~wHp~CF~C~  166 (499)
                      |.-|++.+.+..+|.+-.-.-|+-||-|+
T Consensus       271 CTLC~ERLEDTHFVQCPSVp~HKFCFPCS  299 (352)
T KOG3579|consen  271 CTLCHERLEDTHFVQCPSVPSHKFCFPCS  299 (352)
T ss_pred             ehhhhhhhccCceeecCCCcccceecccC
Confidence            44455554444444444444444444443


No 173
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=20.45  E-value=86  Score=22.87  Aligned_cols=11  Identities=27%  Similarity=0.567  Sum_probs=7.2

Q ss_pred             Ccccchhhhhh
Q 010849          182 KDPYHKSCFKE  192 (499)
Q Consensus       182 g~~YC~~CY~~  192 (499)
                      +.-+|..||.+
T Consensus        26 d~dlC~~Cf~~   36 (44)
T smart00291       26 DYDLCQSCFAK   36 (44)
T ss_pred             CccchHHHHhC
Confidence            34568888765


No 174
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]
Probab=20.32  E-value=38  Score=39.13  Aligned_cols=27  Identities=19%  Similarity=0.491  Sum_probs=17.7

Q ss_pred             cccchhhhhhhc---cccccccCCccCCCC
Q 010849          183 DPYHKSCFKELT---HPKCEVCHQYIPTNG  209 (499)
Q Consensus       183 ~~YC~~CY~~~f---~pkC~~C~~~I~~~~  209 (499)
                      +.||..|...++   .-+|..|+.+..+++
T Consensus       663 H~FC~~Cvq~r~etRqRKCP~Cn~aFganD  692 (698)
T KOG0978|consen  663 HVFCEECVQTRYETRQRKCPKCNAAFGAND  692 (698)
T ss_pred             hHHHHHHHHHHHHHhcCCCCCCCCCCCccc
Confidence            455666666555   456888888776654


Done!