Citrus Sinensis ID: 010861


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MTIHLRRSSPSIHQLAQIQRLHSRQLSAPPESPSASLPVLSKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTLTNDTTDDDDDDRQSSSSSLFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKDIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIGKFLC
cEEEEccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHccccHHHHHHHccccccccccccccHHHHHHHHccccccccccHHHcccccccccccccccccccccEEEEccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccHHcHHHHHHHHHHHHHccccccccc
cEEEEccccccHHHHHHHHHHHHHcccccccccccccccEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHccccHHHEEEEEEEEccccEEEEcHHHHHHHHcccccccccccccccHcccccccccccccccccEEEEEcccccEEEcccccccccEEEEEEEcccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccHHEEHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHEEEHHHHcccccccEEcHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHcc
mtihlrrsspsiHQLAQIQRLHsrqlsappespsaslpvlskasnantdhlkDCIFDSLARWFSGIVVGSSLGLLYwssnsdsistksslfpvsflsfadwsmstltndttddddddrqssssslfrklslpdyssnflfgeaYRRKIFFNYEkrirlrsppEKVFEYFASlrspegellmrpaDLMRaivpvfppseshlvrdgylrgerrpgelrcapseffmlfdmnndglisfkdipessfsVAFKMfdidnngeisKEEFKQVMALMRShnrqgafhrdglrtglnvkgpvengglveyffgedgrarLQHEKFVQFMRNLYEEMLRLEFAhydykqrgtisaEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSygkvnglltrddFQRAAYRVCGILLTDNVIDIIFQVfdsnrdgnlsLEEFVRVLHNRerdiaqpvetGILGFLNCcwnftnnssigkflc
mtihlrrsspsihQLAQIQRLHSRQLSAPPESPSASLPVLSKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTltndttddddddrqssssslfrklslpdyssnflfgeaYRRKIFFNyekrirlrsppEKVFEYFASLRSPEGELLMRPADLMRAIVpvfppseshlvrdgYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKDIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVfdsnrdgnlSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFtnnssigkflc
MTIHLRRSSPSIHQLAQIQRLHSRQlsappespsaslpvlsKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWssnsdsistkssLFPVSFLSFADWsmstltndttddddddrqsssssLFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKDIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIGKFLC
************************************************DHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSM*************************LSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKDIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMR****QGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIG****
********SPSIH*LA***************************************FDSLARWFSGIVVGSSLGLLYWSSN************************************************************GEAYRRKIFFNYEK*****SPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPP*E***********ERRPGELRCAPSEFFMLFDMNNDGLISFKDIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRV*****************GFLNCCWNFTNNSSIGKFLC
*************************************PVLSKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTLTNDT**************LFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKDIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIGKFLC
MTIHLRRSSPSIHQLAQIQRLHSRQL***********************HLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSM*********************************NFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKDIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHN***************VKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIGKFLC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIHLRRSSPSIHQLAQIQRLHSRQLSAPPESPSASLPVLSKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTLTNDTTDDDDDDRQSSSSSLFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKDIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHxxxxxxxxxxxxxxxxxxxxxITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSSIGKFLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query499 2.2.26 [Sep-21-2011]
B1H2N3473 Calcium uptake protein 1, yes no 0.875 0.923 0.285 7e-43
Q8VCX5477 Calcium uptake protein 1, yes no 0.835 0.874 0.287 2e-42
Q6P6Q9477 Calcium uptake protein 1, yes no 0.827 0.865 0.291 3e-42
Q0IIL1478 Calcium uptake protein 1, yes no 0.691 0.721 0.313 3e-41
Q9BPX6476 Calcium uptake protein 1, yes no 0.691 0.724 0.313 3e-41
Q4R518476 Calcium uptake protein 1, N/A no 0.691 0.724 0.313 3e-41
D2HZB0481 Calcium uptake protein 1, yes no 0.691 0.717 0.308 8e-39
A4IG32489 Calcium uptake protein 1, yes no 0.687 0.701 0.297 5e-38
A2VEI2525 Calcium uptake protein 1 yes no 0.681 0.647 0.305 3e-36
A8WQT4533 Calcium uptake protein 1 N/A no 0.665 0.622 0.301 5e-36
>sp|B1H2N3|MICU1_XENTR Calcium uptake protein 1, mitochondrial OS=Xenopus tropicalis GN=micu1 PE=2 SV=2 Back     alignment and function desciption
 Score =  175 bits (444), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 136/477 (28%), Positives = 222/477 (46%), Gaps = 40/477 (8%)

Query: 35  ASLPVLSKASNANTDHLKDCIFDSLARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVS 94
           A L  +S+  +   +H +      +A +     V +S GLL+  +N+++ S+        
Sbjct: 11  AGLAAVSRRYHGVANHARSRRRLMMAAFVGATAVSASAGLLWKRANAEAQSS-------- 62

Query: 95  FLSFADWSMSTLTNDTTDDDDDDRQSSSSSLFRKLSLPDYSSNFLFGEAYRRKIFFNYEK 154
                  SM   T++   +D D    SS         P           +R +    YE 
Sbjct: 63  ----VKHSMREETSEKEKEDADQAVESSDE-----DQPQEGKKKKARVGFRDRKVMEYEN 113

Query: 155 RIRLRSPPEKVFEYFASLR----SPEGELLMRPADLMRAIVPVFPPSESHLVRDGYL--- 207
           RIR  S P+K+F YFA+L+    S E E+ M P D +R+I P     E +L  D ++   
Sbjct: 114 RIRAYSTPDKIFRYFATLKVIHESGESEVFMTPQDFVRSITPNEKQPE-NLGLDQFIIKR 172

Query: 208 -RGERRPGELRCAPSEFFMLFDMNNDGLISFKD---------IPESSFSVAFKMFDIDNN 257
             G++   E      E  + + +   GLISF D          P+ +F +AFKMFD++ +
Sbjct: 173 YDGKKISQEREKFADEDSIFYSLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGD 232

Query: 258 GEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHE 317
           GE+  EEF+QV +++RS    G  HRD   TG  +K    +  L  YFFG D + +L  +
Sbjct: 233 GEVDMEEFEQVQSIIRSQTSMGMRHRDRSTTGNTLKTGF-SSALTTYFFGADLKGKLTIK 291

Query: 318 KFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNE 377
            F++F R L  ++L+LEF  +D    G I+   F  SM+ +       KL + + QLK +
Sbjct: 292 NFLEFQRKLQHDVLKLEFERHD-PVDGHITERQFG-SMLLAYSGVQSKKLTHMLKQLK-K 348

Query: 378 RHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDN 437
           R      +TFEE +NF    + +     AL  Y      L +   Q+ A  V  + L+D+
Sbjct: 349 RFKDAEGLTFEEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDH 408

Query: 438 VIDIIFQVFDSNRDGNLSLEEFVRVLHNR-ERDIAQPVETGILGFLNCCWNFTNNSS 493
           V D++F +FD + +G LS +EF+ ++  R  R + +P + G    +   W     ++
Sbjct: 409 VCDVVFALFDCDGNGELSNKEFIAIMKQRLMRGLEKPKDMGFTRLMRAMWKCAQETA 465




Key regulator of mitochondrial calcium uptake required for calcium entry into mitochondrion. May act as a calcium sensor via its EF-hand domains, gating the activity of a calcium channel partner.
Xenopus tropicalis (taxid: 8364)
>sp|Q8VCX5|MICU1_MOUSE Calcium uptake protein 1, mitochondrial OS=Mus musculus GN=Micu1 PE=2 SV=1 Back     alignment and function description
>sp|Q6P6Q9|MICU1_RAT Calcium uptake protein 1, mitochondrial OS=Rattus norvegicus GN=Micu1 PE=2 SV=1 Back     alignment and function description
>sp|Q0IIL1|MICU1_BOVIN Calcium uptake protein 1, mitochondrial OS=Bos taurus GN=MICU1 PE=2 SV=1 Back     alignment and function description
>sp|Q9BPX6|MICU1_HUMAN Calcium uptake protein 1, mitochondrial OS=Homo sapiens GN=MICU1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R518|MICU1_MACFA Calcium uptake protein 1, mitochondrial OS=Macaca fascicularis GN=MICU1 PE=2 SV=2 Back     alignment and function description
>sp|D2HZB0|MICU1_AILME Calcium uptake protein 1, mitochondrial OS=Ailuropoda melanoleuca GN=MICU1 PE=3 SV=1 Back     alignment and function description
>sp|A4IG32|MICU1_DANRE Calcium uptake protein 1, mitochondrial OS=Danio rerio GN=micu1 PE=2 SV=1 Back     alignment and function description
>sp|A2VEI2|MICU1_DROME Calcium uptake protein 1 homolog, mitochondrial OS=Drosophila melanogaster GN=CG4495 PE=2 SV=1 Back     alignment and function description
>sp|A8WQT4|MICU1_CAEBR Calcium uptake protein 1 homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG01795 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query499
224143217488 predicted protein [Populus trichocarpa] 0.943 0.965 0.667 0.0
255548828540 calcium ion binding protein, putative [R 0.937 0.866 0.664 0.0
359475867474 PREDICTED: calcium uptake protein 1, mit 0.913 0.962 0.629 1e-172
297802820496 calcium-binding EF hand family protein [ 0.857 0.862 0.659 1e-164
15236653498 EF-hand, calcium binding motif-containin 0.857 0.859 0.654 1e-163
449455563476 PREDICTED: calcium uptake protein 1, mit 0.911 0.955 0.609 1e-159
356562068487 PREDICTED: calcium uptake protein 1, mit 0.751 0.770 0.716 1e-157
307136299476 calcium ion binding protein [Cucumis mel 0.831 0.871 0.640 1e-157
225463065488 PREDICTED: calcium uptake protein 1, mit 0.933 0.954 0.584 1e-153
356518234518 PREDICTED: calcium uptake protein 1, mit 0.813 0.783 0.622 1e-152
>gi|224143217|ref|XP_002324884.1| predicted protein [Populus trichocarpa] gi|222866318|gb|EEF03449.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/503 (66%), Positives = 394/503 (78%), Gaps = 32/503 (6%)

Query: 5   LRRSSPSIHQLAQIQRLHSRQLSAPPESPSASLPVLSKASNANTDHLKDCIFDSLARWFS 64
           L+RS PSI QL  IQRLHSR LS P + P+  LP+++  S +NTD+       +L+R FS
Sbjct: 8   LKRSRPSIKQLYLIQRLHSRHLSTPSQ-PNTPLPLIT-TSTSNTDNHTS---KTLSRLFS 62

Query: 65  GIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTLTNDTTDDDDDDRQSSSSS 124
           G+  GS+  LLYWS N           P  F SFADWS  +  ND              S
Sbjct: 63  GLAAGSTFVLLYWSLNDSK--------PTQFFSFADWSTESKVND----------RRLIS 104

Query: 125 LFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRSPEGELLMRPA 184
              KLSLPDYSSN++FG+A+RRKIFFNYEKRIRLRSPPEKVFEYFASLR+P+GE+LM P 
Sbjct: 105 FLPKLSLPDYSSNYIFGDAFRRKIFFNYEKRIRLRSPPEKVFEYFASLRTPDGEVLMTPE 164

Query: 185 DLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEFFMLFDMNNDGLISFKD----- 239
           DLMRA+VPVFPPSESHLVRDGYL+GER PGELRC  SEFFMLFD+NNDGLISFK+     
Sbjct: 165 DLMRAVVPVFPPSESHLVRDGYLKGERNPGELRCTSSEFFMLFDVNNDGLISFKEYIFFA 224

Query: 240 ----IPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGP 295
               IPESSFSVAF+MFD +NNGEI KEEFK+VMALMR+ NRQGA HRDGLR GL V G 
Sbjct: 225 TLLSIPESSFSVAFRMFDFNNNGEIDKEEFKKVMALMRAQNRQGAVHRDGLRPGLKVHGS 284

Query: 296 VENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSM 355
           VENGGLVE+FFG+DG+A L+H+KF+QFMR+L  E+LRLEFAHYDYK RGTISA+DFALSM
Sbjct: 285 VENGGLVEHFFGKDGKASLRHDKFIQFMRDLNNEILRLEFAHYDYKLRGTISAKDFALSM 344

Query: 356 VASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNG 415
           VASADM HL KLL+RVD+L ++ +L  LRIT EEFK+FAELR+KL PF LALFSYGKVNG
Sbjct: 345 VASADMSHLGKLLDRVDELNDQANLGGLRITLEEFKSFAELRKKLLPFSLALFSYGKVNG 404

Query: 416 LLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVE 475
           LL R+DFQRAA  VCG+ L+DNV++IIF +FDSN DG+LS +EFVRVLH RERDIAQPVE
Sbjct: 405 LLMREDFQRAASHVCGVSLSDNVVEIIFHLFDSNHDGSLSADEFVRVLHRRERDIAQPVE 464

Query: 476 TGILGFLNCCWNFTNNSSIGKFL 498
           +G+ GFL+CC+N   NS IG+F+
Sbjct: 465 SGLAGFLSCCFNRAANSPIGRFI 487




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255548828|ref|XP_002515470.1| calcium ion binding protein, putative [Ricinus communis] gi|223545414|gb|EEF46919.1| calcium ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359475867|ref|XP_003631765.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Vitis vinifera] gi|296082107|emb|CBI21112.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297802820|ref|XP_002869294.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi|297315130|gb|EFH45553.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15236653|ref|NP_194934.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] gi|2827631|emb|CAA16584.1| putative protein [Arabidopsis thaliana] gi|7270110|emb|CAB79924.1| putative protein [Arabidopsis thaliana] gi|18176110|gb|AAL59985.1| unknown protein [Arabidopsis thaliana] gi|21689743|gb|AAM67515.1| unknown protein [Arabidopsis thaliana] gi|332660599|gb|AEE85999.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449455563|ref|XP_004145522.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Cucumis sativus] gi|449485161|ref|XP_004157086.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356562068|ref|XP_003549296.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|307136299|gb|ADN34123.1| calcium ion binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|225463065|ref|XP_002266120.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356518234|ref|XP_003527784.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query499
TAIR|locus:2116662498 AT4G32060 [Arabidopsis thalian 0.881 0.883 0.627 8.1e-147
MGI|MGI:2384909477 Micu1 "mitochondrial calcium u 0.669 0.700 0.336 3.2e-42
RGD|735033477 Micu1 "mitochondrial calcium u 0.669 0.700 0.336 4e-42
UNIPROTKB|Q9BPX6476 MICU1 "Calcium uptake protein 0.669 0.701 0.330 1.4e-41
UNIPROTKB|B1H2N3473 micu1 "Calcium uptake protein 0.669 0.706 0.325 1.4e-41
UNIPROTKB|Q4R518476 MICU1 "Calcium uptake protein 0.669 0.701 0.330 1.4e-41
UNIPROTKB|E1BWC6480 MICU1 "Uncharacterized protein 0.669 0.695 0.330 2.2e-41
UNIPROTKB|Q0IIL1478 MICU1 "Calcium uptake protein 0.669 0.698 0.327 2.8e-41
UNIPROTKB|H9KVB8476 MICU1 "Calcium uptake protein 0.669 0.701 0.327 2.8e-41
UNIPROTKB|F1SU87479 MICU1 "Uncharacterized protein 0.669 0.697 0.327 4.6e-41
TAIR|locus:2116662 AT4G32060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1434 (509.9 bits), Expect = 8.1e-147, P = 8.1e-147
 Identities = 288/459 (62%), Positives = 345/459 (75%)

Query:    46 ANTDHLKDCIFD-SLARWFSGIVVGSSLGLLYWXXXXXXXXXXXXLFPVS-FLSFADWXX 103
             +  D LK  +   SLA+W +GI  GS+LG LYW            LF  S  LSFAD   
Sbjct:    46 SGADPLKCTVSGGSLAKWITGISAGSALGFLYWSSGSSDSISG--LFGGSNLLSFAD--- 100

Query:   104 XXXXXXXXXXXXXXXXXXXXXLFRKLSLPDYSSNFLFGEAYRRKIFFNYEKRIRLRSPPE 163
                                     KLSLP YSS F+FG+AYRRKIFFNYEKR+RL+SPPE
Sbjct:   101 ---SSTPSVCGVKVGDLKPRSFIPKLSLPGYSSGFIFGDAYRRKIFFNYEKRLRLQSPPE 157

Query:   164 KVFEYFASLRSPEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPGELRCAPSEF 223
             KVFEYFAS+R+ +GE+LM+PADLMRAIVPVFPPSESHLVR+GYL GER PGELRC+PSEF
Sbjct:   158 KVFEYFASVRTDKGEILMKPADLMRAIVPVFPPSESHLVREGYLTGERNPGELRCSPSEF 217

Query:   224 FMLFDMNNDGLISFKD---------IPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRS 274
             FMLFD++NDGLISFK+         IPESSF+VAFKMFD DNNGEI KEEFK VM+LMRS
Sbjct:   218 FMLFDVDNDGLISFKEYIFFVTLLSIPESSFAVAFKMFDTDNNGEIDKEEFKTVMSLMRS 277

Query:   275 HNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLE 334
              +RQG  HRDGLRTGL++ G VE+GGLVEYFFG+DG  +L+H+KF +FM++L EEMLRLE
Sbjct:   278 QHRQGVGHRDGLRTGLHMTGSVEDGGLVEYFFGKDGSQKLKHDKFTKFMKDLTEEMLRLE 337

Query:   335 FAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEFKNFA 394
             FAHYDYK+RG+ISA+DFALSMVA+AD  HL+KLL+RV+ L    HL D+RI+ +EFK F 
Sbjct:   338 FAHYDYKRRGSISAKDFALSMVAAADASHLSKLLDRVESLSEHPHLRDMRISLKEFKQFD 397

Query:   395 ELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNL 454
             ELR KL PF LALF+YGK NGLLT  DF+RAA +VCGI L+DNVI+I F VFDSN+DGNL
Sbjct:   398 ELRSKLGPFSLALFAYGKANGLLTMKDFKRAASQVCGITLSDNVIEIAFHVFDSNQDGNL 457

Query:   455 SLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNNSS 493
             S++EF+RVLH RERD+AQP+  G+  + +  W  + N S
Sbjct:   458 SVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWKGSKNCS 496




GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
MGI|MGI:2384909 Micu1 "mitochondrial calcium uptake 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|735033 Micu1 "mitochondrial calcium uptake 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BPX6 MICU1 "Calcium uptake protein 1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B1H2N3 micu1 "Calcium uptake protein 1, mitochondrial" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R518 MICU1 "Calcium uptake protein 1, mitochondrial" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWC6 MICU1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IIL1 MICU1 "Calcium uptake protein 1, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H9KVB8 MICU1 "Calcium uptake protein 1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SU87 MICU1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query499
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 8e-10
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 5e-07
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 1e-05
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 2e-05
pfam0003629 pfam00036, efhand, EF hand 5e-05
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-04
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 3e-04
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 3e-04
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 0.001
pfam1320225 pfam13202, EF_hand_3, EF hand 0.001
pfam1320225 pfam13202, EF_hand_3, EF hand 0.002
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 0.003
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
 Score = 54.1 bits (131), Expect = 8e-10
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 1/50 (2%)

Query: 414 NGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVL 463
            GL+TR++ +RA   + GI L++  +DI+F+ FD++ DG +S EEF  +L
Sbjct: 2   KGLITREELKRA-LALLGISLSEEEVDILFREFDTDGDGKISFEEFCVLL 50


Length = 53

>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 499
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 100.0
KOG0751 694 consensus Mitochondrial aspartate/glutamate carrie 99.82
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.67
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.62
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.52
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.5
PTZ00183158 centrin; Provisional 99.5
PTZ00184149 calmodulin; Provisional 99.5
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.49
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.48
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 99.46
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.45
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 99.37
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.24
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 99.23
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.18
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.18
PTZ00183158 centrin; Provisional 99.17
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 99.13
PTZ00184149 calmodulin; Provisional 99.12
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 99.1
KOG0036 463 consensus Predicted mitochondrial carrier protein 99.04
KOG4251362 consensus Calcium binding protein [General functio 98.93
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.91
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.86
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 98.86
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.81
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.74
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.72
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.61
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.6
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.59
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 98.52
KOG0377631 consensus Protein serine/threonine phosphatase RDG 98.49
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.47
KOG0036 463 consensus Predicted mitochondrial carrier protein 98.44
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.43
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.4
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.39
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 98.39
KOG0038189 consensus Ca2+-binding kinase interacting protein 98.35
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.34
KOG4251362 consensus Calcium binding protein [General functio 98.32
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.31
cd0005267 EH Eps15 homology domain; found in proteins implic 98.3
PLN02964 644 phosphatidylserine decarboxylase 98.28
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.27
PLN02964 644 phosphatidylserine decarboxylase 98.25
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.24
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.23
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.08
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.03
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.03
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.02
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.96
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 97.95
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 97.94
cd0005267 EH Eps15 homology domain; found in proteins implic 97.93
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.9
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.9
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 97.87
cd0021388 S-100 S-100: S-100 domain, which represents the la 97.82
KOG0038189 consensus Ca2+-binding kinase interacting protein 97.82
KOG0377631 consensus Protein serine/threonine phosphatase RDG 97.76
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.75
PF1465866 EF-hand_9: EF-hand domain 97.75
KOG0751 694 consensus Mitochondrial aspartate/glutamate carrie 97.72
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.71
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 97.64
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.59
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.5
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.48
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.38
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.24
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.23
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.21
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 97.21
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 97.21
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.18
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 97.01
KOG4666412 consensus Predicted phosphate acyltransferase, con 96.95
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.84
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.81
KOG4666412 consensus Predicted phosphate acyltransferase, con 96.74
cd0503088 calgranulins Calgranulins: S-100 domain found in p 96.74
PF1465866 EF-hand_9: EF-hand domain 96.7
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 96.66
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.34
KOG0169 746 consensus Phosphoinositide-specific phospholipase 95.95
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 95.81
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.42
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.39
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.17
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 95.13
KOG4065144 consensus Uncharacterized conserved protein [Funct 94.99
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 94.6
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 94.33
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 94.17
KOG4065144 consensus Uncharacterized conserved protein [Funct 93.1
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 92.5
KOG0169 746 consensus Phosphoinositide-specific phospholipase 90.72
PLN02952 599 phosphoinositide phospholipase C 90.59
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 90.49
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 89.76
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 88.72
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 87.87
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 86.96
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 85.53
KOG1955 737 consensus Ral-GTPase effector RALBP1 [Intracellula 83.71
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 80.21
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=1.8e-62  Score=487.46  Aligned_cols=422  Identities=34%  Similarity=0.539  Sum_probs=347.3

Q ss_pred             HHHHhhhhhhcccceeEEeecCCCCCccccCCCccccccccccccccccCCCCCCCCccccccccccccccCCCCcCccc
Q 010861           59 LARWFSGIVVGSSLGLLYWSSNSDSISTKSSLFPVSFLSFADWSMSTLTNDTTDDDDDDRQSSSSSLFRKLSLPDYSSNF  138 (499)
Q Consensus        59 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~  138 (499)
                      +. |++|+..||+. ++||.+   .+.+++-++.+..   .+-+.|.+.    ..+..+.  ......+.-..|..+.+.
T Consensus        50 l~-~~~g~s~~s~~-~~~w~~---~~~l~~~~g~s~~---~~~~~~~~~----~~~v~~~--~~a~~~~~~~~~~~~~~~  115 (489)
T KOG2643|consen   50 LA-WIGGHSAGSSP-VLDWGS---KRKLSRDFGFSTK---QGKRKPSPT----EAEVSAV--EEAGGIGADLHPHQSKKK  115 (489)
T ss_pred             EE-eeccccccCce-eeecCC---chhhhhhcccCcc---ccccCCCcc----chhhhcc--ccccccccccccccccch
Confidence            44 99999999998 899973   3444433333332   122222211    1111111  334445555556666666


Q ss_pred             hhhhhhhhhhhhhhhcccccCCChHHHHHHHhcccC----CCCceecCHHHHHHhhccCCCCCCccccccccccCCCCCC
Q 010861          139 LFGEAYRRKIFFNYEKRIRLRSPPEKVFEYFASLRS----PEGELLMRPADLMRAIVPVFPPSESHLVRDGYLRGERRPG  214 (499)
Q Consensus       139 ~~~~~~r~~~~~~ye~rir~~s~~~~vF~~fas~~~----~dG~~~Mt~~dF~~~l~~~~~~~~~~~~~~~~l~g~~~p~  214 (499)
                      ..+..||++++.+||+|||.+++|+++|+|||+++.    ++|++||||+||+++++|..++.+......-..-++..+.
T Consensus       116 ~~~~~~r~r~~~~yE~rlr~~s~P~kiFryFAtvk~~~~~~~~evyMTP~DFlrSi~p~~~qpe~~gld~~k~~~~~~~~  195 (489)
T KOG2643|consen  116 RKGSGFRERKIMEYENRLRLYSTPDKIFRYFATVKYKNDSGKGEVYMTPEDFLRSITPGAKQPERLGLDKLKDIDEKLKK  195 (489)
T ss_pred             hhccchhhhHhhhhhhhhhhcCCHHHHHHHhheeeeeccCCCceEEeCHHHHHHhcCCCCCCchhhhhHHHhhhchhccc
Confidence            677999999999999999999999999999999983    6799999999999999999887765332222222334445


Q ss_pred             ccCCChhHHhhhhcCCCCcceeccC---------CCchHHHHHHHHhccCCCCceeHHHHHHHHHHHHhccccccccccc
Q 010861          215 ELRCAPSEFFMLFDMNNDGLISFKD---------IPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDG  285 (499)
Q Consensus       215 ~~~~~~~~lF~~fD~d~dG~Isf~E---------~~~~~l~~~F~~fD~dgdG~I~~~Ef~~~l~~~~~~~~~g~~~~~~  285 (499)
                      ++.+.+..-.-.++.+.+|.|+|.|         +++..++.+|+|||.||||.|+.+||..+...+.++...|+.|+++
T Consensus       196 ~~~~~~~~~siF~~lg~~GLIsfSdYiFLlTlLS~p~~~F~IAFKMFD~dgnG~IdkeEF~~v~~li~sQ~~~g~~hrd~  275 (489)
T KOG2643|consen  196 ELPKFSDGDSIFYKLGESGLISFSDYIFLLTLLSIPERNFRIAFKMFDLDGNGEIDKEEFETVQQLIRSQTSVGVRHRDH  275 (489)
T ss_pred             cCccCCCCCeeEEEcCCCCeeeHHHHHHHHHHHccCcccceeeeeeeecCCCCcccHHHHHHHHHHHHhccccceecccC
Confidence            5555444334446888999999999         8999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCCCccccchhHhhhccCCCcccchhhHHHHHHHHHHHHHHHHHhhcccCCCCcccHHHHHHHHHHhc--Ccch
Q 010861          286 LRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASA--DMGH  363 (499)
Q Consensus       286 ~~~g~~~~~~~e~~~~l~~~fD~d~dg~Is~eEF~~~l~~l~~e~l~~~F~~~D~d~dG~Is~~Ef~~~L~~~~--~~~~  363 (499)
                      ..++...... .+..++.++|+++++++|+++||.+++++++.|+++..|.++|+..+|.|+..+|+.+|..+.  ....
T Consensus       276 ~tt~~s~~~~-~nsaL~~yFFG~rg~~kLs~deF~~F~e~Lq~Eil~lEF~~~~~~~~g~Ise~DFA~~lL~~a~~n~~~  354 (489)
T KOG2643|consen  276 FTTGNSFKVE-VNSALLTYFFGKRGNGKLSIDEFLKFQENLQEEILELEFERFDKGDSGAISEVDFAELLLAYAGVNSKK  354 (489)
T ss_pred             ccccceehhh-hhhhHHHHhhccCCCccccHHHHHHHHHHHHHHHHHHHHHHhCcccccccCHHHHHHHHHHHcccchHh
Confidence            8877655432 345588899999999999999999999999999999999999999999999999999999987  4455


Q ss_pred             HHHHHHHHHhhhcccCCCCcccCHHHHHHHHHHHhhhHHHHHHhhhcCCCCCccCHHHHHHHHHHHhCCCCCHHHHHHHH
Q 010861          364 LNKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIF  443 (499)
Q Consensus       364 ~~~ll~~v~~~~~~~~~~dg~Is~eeF~~f~~ll~~~~~~~~af~~~~d~dG~Is~eEf~~~l~~~~g~~lt~~ei~~lf  443 (499)
                      ...+++++.....+   .+..|+++||+.|+.+++++.+++.|+..|...++.|+..+|++++..++|+.|++.+++.+|
T Consensus       355 k~~~lkrvk~kf~~---~~~gISl~Ef~~Ff~Fl~~l~dfd~Al~fy~~Ag~~i~~~~f~raa~~vtGveLSdhVvdvvF  431 (489)
T KOG2643|consen  355 KHKYLKRVKEKFKD---DGKGISLQEFKAFFRFLNNLNDFDIALRFYHMAGASIDEKTFQRAAKVVTGVELSDHVVDVVF  431 (489)
T ss_pred             HHHHHHHHHHhccC---CCCCcCHHHHHHHHHHHhhhhHHHHHHHHHHHcCCCCCHHHHHHHHHHhcCcccccceeeeEE
Confidence            56688888876543   266899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCCCcccHHHHHHHHhhhcc-CCCCCcccchhHHHHhHhhccccCcccccC
Q 010861          444 QVFDSNRDGNLSLEEFVRVLHNRER-DIAQPVETGILGFLNCCWNFTNNSSIGKFL  498 (499)
Q Consensus       444 ~~~D~n~DG~Is~~EF~~~l~~r~~-~~~~p~~~g~~~~~~~~~~~~~~~~~~~~~  498 (499)
                      +.||.|+||.|+++||+.+|++|++ +++.|++.|+.++|+|+|+|+|+|+..|.+
T Consensus       432 ~IFD~N~Dg~LS~~EFl~Vmk~Rmhrgl~~p~~~gl~~~~~~v~kc~k~~~~a~~~  487 (489)
T KOG2643|consen  432 TIFDENNDGTLSHKEFLAVMKRRMHRGLELPKDTGLLRYMKAVKKCIKEVSSAWPL  487 (489)
T ss_pred             EEEccCCCCcccHHHHHHHHHHHhhccccCCcccchHHHHHHHHHHHHhhhhhccC
Confidence            9999999999999999999999995 599999999999999999999999887743



>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query499
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-17
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-12
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-09
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-04
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 3e-12
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 6e-04
2hps_A186 Coelenterazine-binding protein with bound coelent; 1e-11
2hps_A186 Coelenterazine-binding protein with bound coelent; 1e-07
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-06
2hps_A186 Coelenterazine-binding protein with bound coelent; 4e-04
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 9e-11
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-10
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-10
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-05
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 2e-10
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-07
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-05
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-04
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 2e-10
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-09
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 6e-07
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
3li6_A66 Calcium-binding protein; calcium signaling protein 4e-10
3li6_A66 Calcium-binding protein; calcium signaling protein 7e-06
3li6_A66 Calcium-binding protein; calcium signaling protein 2e-04
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-09
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-07
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 9e-06
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 3e-05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-09
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 5e-07
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-05
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-09
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-07
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-05
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 9e-09
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 3e-08
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 2e-04
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 3e-04
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-08
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 7e-08
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-05
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 2e-08
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 2e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 4e-04
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 2e-08
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 6e-05
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 9e-05
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-08
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 3e-07
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 1e-04
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 7e-04
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 3e-08
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 4e-07
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 6e-05
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-08
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-07
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-05
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 3e-08
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 1e-06
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 2e-06
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 4e-06
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 4e-08
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 1e-07
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 1e-04
3lij_A494 Calcium/calmodulin dependent protein kinase with A 4e-08
3lij_A494 Calcium/calmodulin dependent protein kinase with A 5e-08
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-05
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 9e-08
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 4e-07
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 4e-04
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 1e-07
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 1e-05
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-05
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 3e-05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 1e-07
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 3e-05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 2e-04
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 1e-07
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 5e-07
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 8e-07
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 3e-04
1y1x_A191 Leishmania major homolog of programmed cell death 1e-07
1y1x_A191 Leishmania major homolog of programmed cell death 1e-06
1y1x_A191 Leishmania major homolog of programmed cell death 4e-05
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 1e-07
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 5e-05
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 4e-04
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 1e-07
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 9e-06
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 5e-05
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 2e-07
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 2e-07
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 1e-04
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-07
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-05
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 3e-05
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-04
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 3e-07
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 1e-06
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 2e-05
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 4e-05
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 3e-07
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 2e-06
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 3e-04
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 3e-07
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 7e-06
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 2e-05
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 9e-05
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 4e-07
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 9e-07
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 1e-05
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 2e-05
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 4e-07
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 4e-06
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-05
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 6e-07
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 5e-06
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 8e-06
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 7e-07
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 2e-05
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 3e-05
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 2e-04
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 8e-07
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 7e-05
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 6e-04
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 1e-06
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 2e-05
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 7e-05
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 5e-04
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 2e-06
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 3e-06
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-04
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 2e-04
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 2e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 2e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 8e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 5e-05
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 2e-04
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 3e-04
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 2e-06
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-05
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 2e-06
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 7e-04
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-06
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-05
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 6e-05
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-04
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 3e-06
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 4e-06
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 3e-05
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 1e-04
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 3e-06
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 4e-06
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 4e-05
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 4e-06
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 5e-06
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 2e-05
3fwb_A161 Cell division control protein 31; gene gating, com 5e-06
3fwb_A161 Cell division control protein 31; gene gating, com 1e-05
3fwb_A161 Cell division control protein 31; gene gating, com 2e-05
3fwb_A161 Cell division control protein 31; gene gating, com 4e-05
3fwb_A161 Cell division control protein 31; gene gating, com 2e-04
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 5e-06
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 8e-06
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 3e-04
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 5e-06
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 7e-05
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 6e-06
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 3e-04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 7e-06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 2e-05
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 3e-05
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 2e-04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 3e-04
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 8e-06
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 5e-05
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 8e-06
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 1e-04
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 3e-04
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 8e-06
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-04
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-04
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 8e-06
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 9e-06
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 2e-04
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 9e-06
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 4e-04
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 1e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 1e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 1e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 1e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 2e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 1e-04
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 1e-05
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 1e-05
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 5e-04
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 7e-04
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 1e-05
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 1e-05
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 2e-05
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 1e-04
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 2e-05
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 3e-05
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 2e-05
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 1e-04
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 3e-04
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 2e-05
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 2e-05
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 5e-04
2jnf_A158 Troponin C; stretch activated muscle contraction, 2e-05
2jnf_A158 Troponin C; stretch activated muscle contraction, 2e-05
2jnf_A158 Troponin C; stretch activated muscle contraction, 3e-05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 2e-05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 5e-05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 6e-05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 1e-04
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 2e-04
1exr_A148 Calmodulin; high resolution, disorder, metal trans 2e-05
1exr_A148 Calmodulin; high resolution, disorder, metal trans 6e-05
1exr_A148 Calmodulin; high resolution, disorder, metal trans 7e-05
1exr_A148 Calmodulin; high resolution, disorder, metal trans 2e-04
1exr_A148 Calmodulin; high resolution, disorder, metal trans 3e-04
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 3e-05
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 3e-05
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 7e-05
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 3e-05
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 6e-05
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 7e-05
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 3e-05
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 2e-04
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 9e-04
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 4e-05
1c07_A95 Protein (epidermal growth factor receptor pathway 4e-05
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 4e-05
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 4e-05
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 5e-05
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 2e-04
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 5e-04
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 6e-04
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 5e-05
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 7e-05
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 5e-05
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 8e-04
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 6e-05
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 6e-05
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 7e-05
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 7e-05
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 8e-05
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 2e-04
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 9e-05
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 5e-04
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 1e-04
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 1e-04
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 1e-04
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 2e-04
1avs_A90 Troponin C; muscle contraction, calcium-activated, 2e-04
1avs_A90 Troponin C; muscle contraction, calcium-activated, 3e-04
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 2e-04
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-04
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 2e-04
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 5e-04
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 2e-04
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 2e-04
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 3e-04
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 3e-04
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 5e-04
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 3e-04
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 5e-04
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 5e-04
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 6e-04
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 7e-04
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 7e-04
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 9e-04
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
 Score = 82.9 bits (205), Expect = 1e-17
 Identities = 38/253 (15%), Positives = 75/253 (29%), Gaps = 51/253 (20%)

Query: 227 FDMNNDGLISFKDIPE-------SSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQG 279
            + +  G    +           +     F    +  +G+ S ++ KQV+A       +G
Sbjct: 99  LEDDASGYNRLRPSKPMLSEEDTNILRQLFLSSAVSGSGKFSFQDLKQVLAKYADTIPEG 158

Query: 280 -------AFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQFMRNLYEEMLR 332
                      D               G + Y               V          L 
Sbjct: 159 PLKKLFVMVENDT-------------KGRMSY------------ITLVAVA--NDLAALV 191

Query: 333 LEFAHYDYKQRGTISAEDF--ALSMVASADMGHLNKLLNRVDQLKNERHLCDLRITFEEF 390
            +F   D    GT+S ++F      +        + L    D+ +         + F E+
Sbjct: 192 ADFRKIDTNSNGTLSRKEFREHFVRLGFDKKSVQDALFRYADEDE------SDDVGFSEY 245

Query: 391 KNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAYRVCGILLTDNVIDIIFQVFDSNR 450
            +       L+    A   + K +G L++++ Q+               +  F V D + 
Sbjct: 246 VHLGLCLLVLR-ILYAFADFDK-SGQLSKEEVQKVLEDAHIPESARKKFEHQFSVVDVDD 303

Query: 451 DGNLSLEEFVRVL 463
             +LS +EFV ++
Sbjct: 304 SKSLSYQEFVMLV 316


>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query499
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.87
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.86
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.86
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.85
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.76
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.76
1y1x_A191 Leishmania major homolog of programmed cell death 99.75
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.75
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.73
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.71
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.7
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.7
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.7
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.7
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.69
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.68
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.68
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.68
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.67
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.67
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.67
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.66
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.65
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.65
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.65
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.65
3fwb_A161 Cell division control protein 31; gene gating, com 99.65
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.64
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.64
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.64
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.64
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.64
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.63
1y1x_A191 Leishmania major homolog of programmed cell death 99.63
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.63
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.63
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.62
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.62
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.62
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.62
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.61
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.61
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.61
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.61
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.61
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.6
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.6
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.6
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.6
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.6
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.6
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.59
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.59
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.59
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.59
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.58
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.58
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.58
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.58
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.58
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.58
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.57
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.56
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.56
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.56
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.56
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.56
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.56
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.54
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.54
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.54
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.52
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.52
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.52
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.52
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.52
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.52
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.52
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.51
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.51
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.5
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.5
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.5
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.49
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.49
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.49
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.48
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.48
3fwb_A161 Cell division control protein 31; gene gating, com 99.48
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.47
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.47
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.47
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.47
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.47
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.46
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.46
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.46
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.46
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.46
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.45
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.45
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.45
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.44
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.44
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.44
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.44
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.44
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.44
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.44
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.43
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.43
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.43
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.43
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.43
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.42
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.42
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.42
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.42
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.42
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.41
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.4
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.39
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.39
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.39
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.39
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.39
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.39
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.38
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.38
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.38
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.37
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.37
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.37
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.37
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.37
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.36
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.36
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.36
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.35
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.35
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.35
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.35
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.34
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.34
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.34
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.34
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.34
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.33
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.33
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.33
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.33
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.32
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.31
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.31
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.31
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.3
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.3
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.3
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.3
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.3
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.29
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.29
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.27
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.27
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.27
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.27
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.26
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.26
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.22
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.21
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.19
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.16
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.16
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.15
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.15
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.15
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.14
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.14
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.13
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.12
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.11
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.09
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.08
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.07
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.06
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.02
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.0
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.96
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.91
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.88
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.87
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.87
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.87
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.87
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.86
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.85
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.85
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.85
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.83
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.83
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.83
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.83
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.82
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.82
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.82
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.81
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.8
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.8
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.8
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.79
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.79
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.79
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.78
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.76
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.76
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.75
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.74
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.74
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.74
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.74
3li6_A66 Calcium-binding protein; calcium signaling protein 98.74
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.74
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.72
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.71
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.7
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.7
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.7
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.69
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.68
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.68
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.68
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.68
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.67
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.67
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.66
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.66
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.66
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.65
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.65
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.65
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.64
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.64
1c07_A95 Protein (epidermal growth factor receptor pathway 98.64
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.63
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.61
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.61
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.6
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.59
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.56
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.55
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.55
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.54
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.54
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.52
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.52
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.52
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.51
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.51
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.5
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.49
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.47
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.46
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.43
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.42
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.42
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.42
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.41
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.4
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.4
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.37
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.37
3li6_A66 Calcium-binding protein; calcium signaling protein 98.37
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.34
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.34
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.33
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.32
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.32
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.31
1c07_A95 Protein (epidermal growth factor receptor pathway 98.31
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.29
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.29
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.28
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.28
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.27
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.25
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.25
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.25
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.25
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.24
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.24
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.23
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.22
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.2
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.2
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.19
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.18
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.17
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.17
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.16
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.15
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.13
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.08
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.06
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.05
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 97.94
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 97.94
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.88
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.62
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 97.59
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.3
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.3
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.3
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.21
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.21
1nub_A229 Basement membrane protein BM-40; extracellular mod 95.96
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 95.34
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 94.38
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 93.84
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 90.61
2jrf_A184 Tubulin polymerization-promoting protein family me 89.87
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 83.96
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 83.43
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
Probab=99.87  E-value=2.5e-22  Score=195.07  Aligned_cols=214  Identities=14%  Similarity=0.152  Sum_probs=162.0

Q ss_pred             cCCCchHHHHHHHHhccCCCCceeHHHHHHHHHHHHhccccccccccccccCCCCCCCccccchhHhhhccCCCcccchh
Q 010861          238 KDIPESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHE  317 (499)
Q Consensus       238 ~E~~~~~l~~~F~~fD~dgdG~I~~~Ef~~~l~~~~~~~~~g~~~~~~~~~g~~~~~~~e~~~~l~~~fD~d~dg~Is~e  317 (499)
                      .+....+++.+|+.+|.|++|.|+.+||..++..+......            ...........++..+|.+++|.|+++
T Consensus        11 ~~~~~~~l~~~F~~~D~d~~G~i~~~El~~~l~~l~~~~~~------------~~~~~~~~~~~l~~~~D~~~~g~i~~~   78 (263)
T 2f33_A           11 SLITASQFFEIWLHFDADGSGYLEGKELQNLIQELLQARKK------------AGLELSPEMKTFVDQYGQRDDGKIGIV   78 (263)
T ss_dssp             SCCCHHHHHHHHHHHCTTCSSSBCSHHHHHHHHHHHHHHHH------------HTCCCCHHHHHHHHHHTTGGGCCBCHH
T ss_pred             CcccHHHHHHHHHHhCCCCCCCcCHHHHHHHHHHHHhhcCC------------CccchHHHHHHHHHHhCCCCCCcCcHH
Confidence            33567789999999999999999999999999876432100            000011244566677999999999999


Q ss_pred             hHHHHHHHH-------------HHHHHHHHHhhcccCCCCcccHHHHHHHHHHh----cCc---chHHHHHHHHHhhhcc
Q 010861          318 KFVQFMRNL-------------YEEMLRLEFAHYDYKQRGTISAEDFALSMVAS----ADM---GHLNKLLNRVDQLKNE  377 (499)
Q Consensus       318 EF~~~l~~l-------------~~e~l~~~F~~~D~d~dG~Is~~Ef~~~L~~~----~~~---~~~~~ll~~v~~~~~~  377 (499)
                      ||..++...             ..+.++.+|..+|.+++|.|+.+||..++..+    +..   ..+..++..+-.....
T Consensus        79 Ef~~~~~~~~~~~~~~~~~~~~~~~~l~~~F~~~D~d~~G~i~~~el~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~d~  158 (263)
T 2f33_A           79 ELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDS  158 (263)
T ss_dssp             HHHHHTTSCTTHHHHHGGGTSSCHHHHHHHHTTSSTTTCSSBCHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHTCS
T ss_pred             HHHHHHhhhhhHHHHHHHhhccHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHHhcCC
Confidence            999987432             24568899999999999999999999999876    422   2333322222221111


Q ss_pred             cCCCCcccCHHHHHHHHHH--------H---hhhHHHHHHhhhcC-CCCCccCHHHHHHHHHHHhCC----CCCHHHHHH
Q 010861          378 RHLCDLRITFEEFKNFAEL--------R---RKLQPFCLALFSYG-KVNGLLTRDDFQRAAYRVCGI----LLTDNVIDI  441 (499)
Q Consensus       378 ~~~~dg~Is~eeF~~f~~l--------l---~~~~~~~~af~~~~-d~dG~Is~eEf~~~l~~~~g~----~lt~~ei~~  441 (499)
                        .++|.|+|++|..+...        .   .....+..+|..++ +++|.|+.+||+.++.. +|.    .+++++++.
T Consensus       159 --~~dg~i~~~ef~~~~~~~~~~~~~~~~~~~~~~~~~~~F~~~D~d~~G~is~~El~~~l~~-~~~~~~~~~~~~e~~~  235 (263)
T 2f33_A          159 --NNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKD-LCEKNKQELDINNIST  235 (263)
T ss_dssp             --SSSSCBCHHHHHHHSCTTTCSHHHHHHTCCCHHHHHHHHHHHCCSSSSCEEHHHHHHHHHH-HHHHCTTTCCTTTHHH
T ss_pred             --CCCCeEcHHHHHHHHHHHHHHHHHhcCcchHHHHHHHHHHHhCCCCCCcccHHHHHHHHHH-HHHhcCCCCCHHHHHH
Confidence              16899999999987532        1   22456788888887 89999999999999998 465    899999999


Q ss_pred             HHHH-hcCCCCCcccHHHHHHHHhhh
Q 010861          442 IFQV-FDSNRDGNLSLEEFVRVLHNR  466 (499)
Q Consensus       442 lf~~-~D~n~DG~Is~~EF~~~l~~r  466 (499)
                      ++.. +|.|+||.|+|+||+.+|.+.
T Consensus       236 ~~~~~~D~d~dG~i~~~EF~~~~~~~  261 (263)
T 2f33_A          236 YKKNIMALSDGGKLYRTDLALILSAG  261 (263)
T ss_dssp             HHHHHHTTSBTTEECGGGTHHHHCCS
T ss_pred             HHHHhhccCCCCeEcHHHHHHHHhcc
Confidence            9987 799999999999999999764



>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 499
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 4e-10
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 2e-05
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-07
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 8e-06
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-05
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 1e-07
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 5e-05
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 3e-04
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 6e-04
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 6e-07
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 8e-06
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 6e-04
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 8e-07
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-04
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 0.003
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 8e-07
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-04
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 8e-07
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-05
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 1e-06
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 5e-05
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 1e-06
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 0.004
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-06
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-04
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-06
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 5e-05
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-04
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 1e-06
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 2e-06
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-04
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 0.001
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 3e-06
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 3e-06
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 5e-05
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 4e-04
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 5e-06
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 7e-05
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-06
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-04
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 8e-06
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 2e-04
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9e-06
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 9e-06
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.001
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 1e-05
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 1e-05
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 0.002
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 1e-05
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 3e-05
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 7e-05
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-05
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 1e-04
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-05
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 4e-04
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.003
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 2e-05
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 2e-04
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.001
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 3e-05
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 4e-05
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 3e-05
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 1e-04
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 3e-05
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 3e-04
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 5e-05
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 0.001
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 6e-05
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 4e-04
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 6e-05
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 6e-05
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 6e-05
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 0.001
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 7e-05
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 1e-04
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 7e-05
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 0.002
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 7e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 8e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-04
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 9e-05
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 4e-04
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 1e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 1e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 5e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 0.002
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-04
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 4e-04
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.001
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 2e-04
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 0.001
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 2e-04
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 7e-04
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 0.004
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 2e-04
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 3e-04
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.004
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 4e-04
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 4e-04
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 6e-04
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 0.003
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 0.001
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 0.001
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.001
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 0.001
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 0.001
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 0.001
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 0.004
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 0.001
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 0.001
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 0.002
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 0.002
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 0.002
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 0.002
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 0.003
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
domain: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
species: Physarum polycephalum [TaxId: 5791]
 Score = 58.9 bits (141), Expect = 4e-10
 Identities = 31/216 (14%), Positives = 60/216 (27%), Gaps = 26/216 (12%)

Query: 248 AFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFG 307
            F    +  +G+ S ++ KQV+A       +G   +                 L      
Sbjct: 127 LFLSSAVSGSGKFSFQDLKQVLAKYADTIPEGPLKK-----------------LFVMVE- 168

Query: 308 EDGRARLQHEKFVQFMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKL 367
                     K       L      L     D+++  T S    +        +      
Sbjct: 169 -------NDTKGRMSYITLVAVANDLAALVADFRKIDTNSNGTLSRKEFREHFVRLGFDK 221

Query: 368 LNRVDQLKNERHLCDLRITFEEFKNFAELRRKLQPFCLALFSYGKVNGLLTRDDFQRAAY 427
            +  D L       +             L   +     A   + K +G L++++ Q+   
Sbjct: 222 KSVQDALFRYADEDESDDVGFSEYVHLGLCLLVLRILYAFADFDK-SGQLSKEEVQKVLE 280

Query: 428 RVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVL 463
                       +  F V D +   +LS +EFV ++
Sbjct: 281 DAHIPESARKKFEHQFSVVDVDDSKSLSYQEFVMLV 316


>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query499
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.78
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.73
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.7
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.7
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.7
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.67
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.64
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.64
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.63
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.63
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.62
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.61
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.59
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.59
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.57
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.57
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.57
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.57
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.56
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.55
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.55
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.53
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.53
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.53
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.52
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.52
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.51
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.5
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.48
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.48
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.48
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.48
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.47
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.44
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.44
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.44
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.44
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.43
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.43
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.43
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.42
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.41
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.41
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.4
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.37
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.37
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.36
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.35
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.33
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.33
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.32
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.32
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.31
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.31
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.31
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.28
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.28
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.27
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.27
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.26
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.25
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.2
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.19
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.17
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.16
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.15
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.13
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.12
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.11
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.11
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.1
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.09
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.09
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.09
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.08
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.08
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.07
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.07
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.04
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.04
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.01
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.0
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.0
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.98
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.98
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.94
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.93
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.9
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.87
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.85
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.85
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.84
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.82
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.76
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.76
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.75
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.74
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.74
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.73
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.71
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.71
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.67
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.67
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.66
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.66
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.66
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.65
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.64
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.63
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.6
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.58
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.57
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.57
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.56
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.51
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.49
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.49
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.47
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.46
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.45
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.4
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.36
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.35
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.34
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.29
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.24
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.19
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.14
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.12
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.1
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.09
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.05
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.94
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.93
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 97.92
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 97.91
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.89
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 97.87
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.82
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.81
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.74
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.71
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.59
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.5
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.49
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.44
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 96.79
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 96.12
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 96.08
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.01
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 95.74
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 94.93
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 93.87
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 93.56
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 91.07
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 89.06
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 88.52
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
domain: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
species: Physarum polycephalum [TaxId: 5791]
Probab=99.78  E-value=2.4e-19  Score=177.05  Aligned_cols=193  Identities=18%  Similarity=0.212  Sum_probs=153.4

Q ss_pred             chHHHHHHHHhccCCCCceeHHHHHHHHHHHHhccccccccccccccCCCCCCCccccchhHhhhccCCCcccchhhHHH
Q 010861          242 ESSFSVAFKMFDIDNNGEISKEEFKQVMALMRSHNRQGAFHRDGLRTGLNVKGPVENGGLVEYFFGEDGRARLQHEKFVQ  321 (499)
Q Consensus       242 ~~~l~~~F~~fD~dgdG~I~~~Ef~~~l~~~~~~~~~g~~~~~~~~~g~~~~~~~e~~~~l~~~fD~d~dg~Is~eEF~~  321 (499)
                      ...++.+|..+|.||+|.|+.+||..+|..+.                ..++  ......++..+|.|++|.|+|.||..
T Consensus       121 ~~~~~~~F~~~D~~~~g~i~~~e~~~~l~~~~----------------~~~~--~~~~~~~~~~~d~~~~g~i~~~ef~~  182 (321)
T d1ij5a_         121 TNILRQLFLSSAVSGSGKFSFQDLKQVLAKYA----------------DTIP--EGPLKKLFVMVENDTKGRMSYITLVA  182 (321)
T ss_dssp             HHHHHHHHTSSSSTTSSCCCHHHHHHHHHHHH----------------TTSC--SSHHHHHHHHHHHCCSSTHHHHHHTT
T ss_pred             HHHHHHHHHHHcCCCCCeEcHHHHHHHHHHcC----------------Cccc--HHHHHHHHHHHhhcCCccccchhhhh
Confidence            34588999999999999999999999998863                2222  23667778889999999999999998


Q ss_pred             HHHHHHHHHHHHHHhhcccCCCCcccHHHHHHHHHHhcCcchH--HHHHHHHHhhhcccCCCCcccCHHHHHHHHHHHhh
Q 010861          322 FMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHL--NKLLNRVDQLKNERHLCDLRITFEEFKNFAELRRK  399 (499)
Q Consensus       322 ~l~~l~~e~l~~~F~~~D~d~dG~Is~~Ef~~~L~~~~~~~~~--~~ll~~v~~~~~~~~~~dg~Is~eeF~~f~~ll~~  399 (499)
                      .+....  .+...|..+|.+++|.++..++...+...+.....  ..++..++..      .++.+.+.+|..+......
T Consensus       183 ~~~~~~--~~~~~F~~~d~d~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~i~~~ef~~~~~~~~~  254 (321)
T d1ij5a_         183 VANDLA--ALVADFRKIDTNSNGTLSRKEFREHFVRLGFDKKSVQDALFRYADED------ESDDVGFSEYVHLGLCLLV  254 (321)
T ss_dssp             SHHHHH--TSCCCHHHHCTTCCSEECHHHHHHHHHHTTCCCHHHHHHHHHHHCTT------CSSCEEHHHHHHHHHHHHH
T ss_pred             hhhhhh--hhhHHHHHHhhcccccchhHHHhhhhhcccccchHHHHHHHHhhhcc------cccccccccccchhhhhhH
Confidence            876543  45567999999999999999999998887643321  2222222221      5788999999877654443


Q ss_pred             hHHHHHHhhhcC-CCCCccCHHHHHHHHHHHhCC-CCCHHHHHHHHHHhcCCCCCcccHHHHHHHHh
Q 010861          400 LQPFCLALFSYG-KVNGLLTRDDFQRAAYRVCGI-LLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLH  464 (499)
Q Consensus       400 ~~~~~~af~~~~-d~dG~Is~eEf~~~l~~~~g~-~lt~~ei~~lf~~~D~n~DG~Is~~EF~~~l~  464 (499)
                         +..+|..++ +++|.|+.+||+.++.. +|. .++++++..+|..+|.|+||.|+|+||+.+|.
T Consensus       255 ---~~~~F~~~D~d~~G~Is~~E~~~~l~~-~~~~~~~~~~~~~l~~~~D~d~dG~Is~~EF~~~ml  317 (321)
T d1ij5a_         255 ---LRILYAFADFDKSGQLSKEEVQKVLED-AHIPESARKKFEHQFSVVDVDDSKSLSYQEFVMLVL  317 (321)
T ss_dssp             ---HHHHHHHTCSSSCSSEEHHHHHHHHHH-TTCCGGGCSTHHHHHHHHTTTTCSEECHHHHHHHHH
T ss_pred             ---HHHHHHHHhcCCCCCCcHHHHHHHHHH-cCCCcCcHHHHHHHHHHhCCCCCCcCcHHHHHHHHH
Confidence               345566666 79999999999999999 677 48999999999999999999999999999984



>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure