BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 010921
(497 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2EK8|A Chain A, Aminopeptidase From Aneurinibacillus Sp. Strain Am-1
pdb|2EK9|A Chain A, Aminopeptidase From Aneurinibacillus Sp. Strain Am-1 With
Bestatin
Length = 421
Score = 29.3 bits (64), Expect = 5.6, Method: Compositional matrix adjust.
Identities = 14/35 (40%), Positives = 19/35 (54%)
Query: 99 LTGEAILVHRGGCSFTAKANFAEEANASAILIINN 133
L G+ L+ RG SF K A + A A++I NN
Sbjct: 113 LNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNN 147
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.141 0.447
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,559,744
Number of Sequences: 62578
Number of extensions: 598228
Number of successful extensions: 1166
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 11
Number of HSP's that attempted gapping in prelim test: 1164
Number of HSP's gapped (non-prelim): 12
length of query: 497
length of database: 14,973,337
effective HSP length: 103
effective length of query: 394
effective length of database: 8,527,803
effective search space: 3359954382
effective search space used: 3359954382
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)