Citrus Sinensis ID: 010929

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------

MNSSSFSKFLKIYGYDIVLGLIATFYVLAMPYTKVEESFNVQAMHDILYHRHHLDIYDHLEFPGVVPRTFIGALLVSVLASPIILVMSFLHLPKTHGLIAVRLALGCITLSTLRFFRAQQVRYKFGSQVEAFFVILTAFQFHLLFYCTRPLPNILALGIVNLAYGFWLKGDFYAALNCLIFSAVVFRCDMVLLLCPLGLVLLLTKSISLWKALKCCIGMVLLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSFHWYFTSALPRSLLAAYPLCFLGALLDRRVLPFVIPVFTFVLLYSKLPHKELRFIISSVPIFNLSAAVAASRIFMNRKKAFWKLLSIILIGFLLISLGCTAVTFMASYENYPSGYALKYLHQIGHLASNTEEQWVHIDPYSAMNGISRFCENDFPWRYSKEESIPLKEYQNRNFTYLINEHLLVEGYKCLFSMDGFSRVRPQLRFPPFLLIKEPKVYVHGNIKNEDLMNKNWPGC

cccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHEEccccccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccEEEEcccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEEEECccccccccccccccEEEEccEEEEEcccccccccccccccc

*******KFLKIYGYDIVLGLIATFYVLAMPYTKVEESFNVQAMHDILYHRHHLDIYDHLEFPGVVPRTFIGALLVSVLASPIILVMSFLHLPKTHGLIAVRLALGCITLSTLRFFRAQQVRYKFGSQVEAFFVILTAFQFHLLFYCTRPLPNILALGIVNLAYGFWLKGDFYAALNCLIFSAVVFRCDMVLLLCPLGLVLLLTKSISLWKALKCCIGMVLLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSFHWYFTSALPRSLLAAYPLCFLGALLDRRVLPFVIPVFTFVLLYSKLPHKELRFIISSVPIFNLSAAVAASRIFMNRKKAFWKLLSIILIGFLLISLGCTAVTFMASYENYPSGYALKYLHQIGHLASNTEEQWVHIDPYSAMNGISRFCENDFPWRYSKEESIPLKEYQNRNFTYLINEHLLVEGYKCLFSMDGFSRVRPQLRFPPFLLIKEPKVYVHGNIKN******NWPG*

xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase	Required for N-linked oligosaccharide assembly. Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor dolichol-PP-Man(7)GlcNAc(2).	probable	A8MR93
Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase	Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation.	probable	Q23361
Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase	Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation.	probable	Q8VDB2

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RCE, chain A
Confidence level:probable
Coverage over the Query: 86-169
View the alignment between query and template
View the model in PyMOL