BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 010974
(496 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q12191|BUG1_YEAST Binder of USO1 and GRH1 protein 1 OS=Saccharomyces cerevisiae
(strain ATCC 204508 / S288c) GN=BUG1 PE=1 SV=1
Length = 341
Score = 36.2 bits (82), Expect = 0.67, Method: Compositional matrix adjust.
Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 5/72 (6%)
Query: 36 TIRYQQELFAAKEDALRMLLRLKQMLDAKVNEAQVVSLCQQRKIDELEAQLGEAEDIVKD 95
TI+ Q+E ED L L + L + + + +++ + +D+L+ QL E EDI+
Sbjct: 190 TIKKQKE-----EDELTKLRAENEKLTQENKQLKFLNMENETTVDDLQDQLQEKEDIING 244
Query: 96 LRADLREAQDEL 107
L+ DL+ A+DEL
Sbjct: 245 LQNDLQTARDEL 256
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.309 0.124 0.335
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 165,842,527
Number of Sequences: 539616
Number of extensions: 6677439
Number of successful extensions: 24866
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 37
Number of HSP's successfully gapped in prelim test: 365
Number of HSP's that attempted gapping in prelim test: 23898
Number of HSP's gapped (non-prelim): 1408
length of query: 496
length of database: 191,569,459
effective HSP length: 122
effective length of query: 374
effective length of database: 125,736,307
effective search space: 47025378818
effective search space used: 47025378818
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)