Citrus Sinensis ID: 010983


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490------
MNSSSFSKFLKIYGYDIVLGLIATFYVLAMPYTKVEESFNVQAMHDILYHRHHLDIYDHLEFPGVVPRTFIGALLVSVLASPIILVMSFLHLPKTHGLIAVRLALGCITLSTLRFFRAQVRYKFGSQVEAFFVILTAFQFHLLFYCTRPLPNILALGIVNLAYGFWLKGDFYAALNCLIFSAVVFRCDMVLLLCPLGLVLLLTKSISLWKALKCCIGMVLLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSFHWYFTSALPRSLLAAYPLCFLGALLDRRVLPFVIPVFTFVLLYSKLPHKELRFIISSVPIFNLSAAVAASRIFMNRKKAFWKLLSIILIGFLLISLGCTAVTFMASYENYPSGYALKYLHQIGHLASNTEEQWVHIDPYSAMNGISRFCENDFPWRYSKEESIPLKEYQNRNFTYLINEHLLVEGYKCLFSMDGFSRVRPQLRFPPFLLIKEPKVYVHGNIKNEDLMNKNWPGC
cccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccEEEEcccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEEEECccccccccccccccEEEEccEEEEEcccccccccccccccc
*******KFLKIYGYDIVLGLIATFYVLAMPYTKVEESFNVQAMHDILYHRHHLDIYDHLEFPGVVPRTFIGALLVSVLASPIILVMSFLHLPKTHGLIAVRLALGCITLSTLRFFRAQVRYKFGSQVEAFFVILTAFQFHLLFYCTRPLPNILALGIVNLAYGFWLKGDFYAALNCLIFSAVVFRCDMVLLLCPLGLVLLLTKSISLWKALKCCIGMVLLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSFHWYFTSALPRSLLAAYPLCFLGALLDRRVLPFVIPVFTFVLLYSKLPHKELRFIISSVPIFNLSAAVAASRIFMNRKKAFWKLLSIILIGFLLISLGCTAVTFMASYENYPSGYALKYLHQIGHLASNTEEQWVHIDPYSAMNGISRFCENDFPWRYSKEESIPLKEYQNRNFTYLINEHLLVEGYKCLFSMDGFSRVRPQLRFPPFLLIKEPKVYVHGNIKN******NWPG*
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSSSFSKFLKIYGYDIVLGLIATFYVLAMPYTKVEESFNVQAMHDILYHRHHLDIYDHLEFPGVVPRTFIGALLVSVLASPIILVMSFLHLPKTHGLIAVRLALGCITLSTLRFFRAQVRYKFGSQVEAFFVILTAFQFHLLFYCTRPLPNILALGIVNLAYGFWLKGDFYAALNCLIFSAVVFRCDMVLLLCPLGLVLLLTKSISLWKALKCCIGMVLLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSFHWYFTSALPRSLLAAYPLCFLGALLDRRVLPFVIPVFTFVLLYSKLPHKELRFIISSVPIFNLSAAVAASRIFMNRKKAFWKLLSIILIGFLLISLGCTAVTFMASYENYPSGYALKYLHQIGHLASNTEEQWVHIDPYSAMNGISRFCENDFPWRYSKEESIPLKEYQNRNFTYLINEHLLVEGYKCLFSMDGFSRVRPQLRFPPFLLIKEPKVYVHGNIKNEDLMNKNWPGC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase Required for N-linked oligosaccharide assembly. Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor dolichol-PP-Man(7)GlcNAc(2).confidentA8MR93
Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation.probableQ23361
Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation.probableQ9BV10

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RCE, chain A
Confidence level:probable
Coverage over the Query: 86-168
View the alignment between query and template
View the model in PyMOL