Citrus Sinensis ID: 011010


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----
MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATVNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSELMPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLEEYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPQGMLKQIGGVGGLQNLMKQMGSTKDMMGMFGGGE
cHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccHHHHcccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHccccHHHHHccccHHHHHHccccccHHHHHHHccccccccccccccc
MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATVNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPG*******************RYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLEEYKRLAKIWSKMK*************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATVNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSELMPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLEEYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPQGMLKQIGGVGGLQNLMKQMGSTKDMMGMFGGGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle 54 kDa protein 2 Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).confidentP49972
Signal recognition particle 54 kDa protein 3 Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).confidentP49967
Signal recognition particle 54 kDa protein Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).probableQ5R4R6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J37, chain W
Confidence level:very confident
Coverage over the Query: 8-482
View the alignment between query and template
View the model in PyMOL