BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 011021
         (495 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|D Chain D, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|F Chain F, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|H Chain H, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|J Chain J, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|L Chain L, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|N Chain N, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|P Chain P, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGL|B Chain B, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|D Chain D, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|F Chain F, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|H Chain H, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|J Chain J, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|L Chain L, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|N Chain N, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|P Chain P, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGM|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|D Chain D, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|F Chain F, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|H Chain H, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|J Chain J, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|L Chain L, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|N Chain N, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|P Chain P, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
          Length = 592

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 260 PSLQQLTLLFYGARRPRVVEVARS-PHLKKLDLVSVYFADNEFNHLISKFPSLEDLFVT- 317
           P+++ + L + G     ++E +R  P+L+KL++    F++      ++K PSL  L+V  
Sbjct: 463 PNVRWMLLGYVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQG 522

Query: 318 -RCCLPGK 324
            R  + G+
Sbjct: 523 YRASMTGQ 530


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.140    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,149,369
Number of Sequences: 62578
Number of extensions: 503507
Number of successful extensions: 1205
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1204
Number of HSP's gapped (non-prelim): 2
length of query: 495
length of database: 14,973,337
effective HSP length: 103
effective length of query: 392
effective length of database: 8,527,803
effective search space: 3342898776
effective search space used: 3342898776
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)