Citrus Sinensis ID: 011093

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490----
MEILISCVLWLLFTWVWVITLRSFSKGSRKLPPGPTPLPIIGNLLELGHKPHKSLAELAKVHGPIMSLKFGQVTTVVISSATMAKQVLQDHDKSLCNRNVPESVGSIQKDEYGIPWLPVSTKWKKLRKICNLHIFTSQKLDANQDLRRKKIQQLVTFVQESCRTGEPIDVGQAAFDTVVNLLSNSIFSVDLADANSDSAREFKDSMWGLMVEAGRPNLSDFFPMLRKLDIQGVRRRLTRHYIKILEVLDRFIDQRLEQRQEHGFADSKDMLDTLLNISESEEIDRNDIKFVILDLFAAGTETTSSTLEWAVTELLNNSEALSKARLELEQKVGKGNLIEESDITQLPYLQTIVKETLRLHPPVPLLLPRKASADVEITGFIIPKGAQVLVNAWAIGRDTSTWDDPYSFKPERFLGSDVDVKGRNFELIPFGAGRRICPGLPLAIRMLYLMLGSLIKSFDWKLDNEVTSGNIDMEEKFGITLQKAQPLRVVPVAI
ccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHccccEEEEcccccEEEEccHHHHHHHHHHcccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccECHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHcccccccccccccccccccEEcccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEccc
MEILISCVLWLLFTWVWVITLRSFS**********TPLPIIGNLLELGHKPHKSLAELAKVHGPIMSLKFGQVTTVVISSATMAKQVLQDHDKSLCNRNVPESVGSIQKDEYGIPWLPVSTKWKKLRKICNLHIFTSQKLDANQDLRRKKIQQLVTFVQESCRTGEPIDVGQAAFDTVVNLLSNSIFSVDLADANSDSAREFKDSMWGLMVEAGRPNLSDFFPMLRKLDIQGVRRRLTRHYIKILEVLDRFIDQRLE************MLDTLLNISESEEIDRNDIKFVILDLFAAGTETTSSTLEWAVTELLNNSEALSKARLELEQKVGKGNLIEESDITQLPYLQTIVKETLRLHPPVPLLLPRKASADVEITGFIIPKGAQVLVNAWAIGRDTSTWDDPYSFKPERFLGSDVDVKGRNFELIPFGAGRRICPGLPLAIRMLYLMLGSLIKSFDWKLDNEVTSGNIDMEEKFGITLQKAQPLRVVPVAI
xHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEILISCVLWLLFTWVWVITLRSFSKGSRKLPPGPTPLPIIGNLLELGHKPHKSLAELAKVHGPIMSLKFGQVTTVVISSATMAKQVLQDHDKSLCNRNVPESVGSIQKDEYGIPWLPVSTKWKKLRKICNLHIFTSQKLDANQDLRRKKIQQLVTFVQESCRTGEPIDVGQAAFDTVVNLLSNSIFSVDLADANSDSAREFKDSMWGLMVEAGRPNLSDFFPMLRKLDIQGVRRRLTRHYIKILEVLDRFIDQRLEQRQEHGFADSKDMLDTLLNISESEEIDRNDIKFVILDLFAAGTETTSSTLEWAxxxxxxxxxxxxxxxxxxxxxVGKGNLIEESDITQLPYLQTIVKETLRLHPPVPLLLPRKASADVEITGFIIPKGAQVLVNAWAIGRDTSTWDDPYSFKPERFLGSDVDVKGRNFELIPFGAGRRICPGLPLAIRMLYLMLGSLIKSFDWKLDNEVTSGNIDMEEKFGITLQKAQPLRVVPVAI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome P450 76C4 probableO64635
Geraniol 8-hydroxylase Hydroxylase involved in the biosynthesis of hydroxygeraniol, a precursor of the terpenoid indole alkaloids such as vinblastine and vincristine. Also able to hydroxylate in vitro nerol and to catalyze 3'-hydroxylation of the flavanone naringenin to form eriodictyol. No activity with apigenin, kaempferol, p-coumaric acid and ferulic acid as substrates.probableQ8VWZ7
Geraniol 8-hydroxylase Hydroxylase involved in the biosynthesis of hydroxygeraniol, a precursor of the iridoid monoterpenoid swertiamarin.probableD1MI46

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PM0, chain A
Confidence level:very confident
Coverage over the Query: 49-493
View the alignment between query and template
View the model in PyMOL