BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 011181
(491 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3B5Q|A Chain A, Crystal Structure Of A Putative Sulfatase (Np_810509.1)
From Bacteroides Thetaiotaomicron Vpi-5482 At 2.40 A
Resolution
pdb|3B5Q|B Chain B, Crystal Structure Of A Putative Sulfatase (Np_810509.1)
From Bacteroides Thetaiotaomicron Vpi-5482 At 2.40 A
Resolution
Length = 482
Score = 30.4 bits (67), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
Query: 418 STPYVSVQWALRFEFLTTP-KHVQWTRYEHPLLIEG 452
S PYV +W +E++TTP + V+ RY++ +EG
Sbjct: 368 SHPYVVSEWHSEYEYVTTPGRXVRGPRYKYTHYLEG 403
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.134 0.404
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,063,019
Number of Sequences: 62578
Number of extensions: 554166
Number of successful extensions: 1038
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1038
Number of HSP's gapped (non-prelim): 1
length of query: 491
length of database: 14,973,337
effective HSP length: 103
effective length of query: 388
effective length of database: 8,527,803
effective search space: 3308787564
effective search space used: 3308787564
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)