Citrus Sinensis ID: 011217
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 491 | ||||||
| 302143985 | 747 | unnamed protein product [Vitis vinifera] | 0.995 | 0.654 | 0.569 | 1e-144 | |
| 157399680 | 698 | pseudo-response regulator 5 [Castanea sa | 0.985 | 0.693 | 0.522 | 1e-142 | |
| 224132554 | 687 | pseudo response regulator [Populus trich | 0.975 | 0.697 | 0.508 | 1e-132 | |
| 356518667 | 700 | PREDICTED: two-component response regula | 0.953 | 0.668 | 0.472 | 1e-115 | |
| 356509155 | 655 | PREDICTED: two-component response regula | 0.934 | 0.700 | 0.460 | 1e-107 | |
| 357464211 | 685 | Two-component response regulator-like PR | 0.953 | 0.683 | 0.434 | 1e-96 | |
| 449497396 | 696 | PREDICTED: two-component response regula | 0.959 | 0.676 | 0.412 | 8e-92 | |
| 224132558 | 477 | response regulator [Populus trichocarpa] | 0.784 | 0.807 | 0.467 | 9e-92 | |
| 449456441 | 696 | PREDICTED: two-component response regula | 0.959 | 0.676 | 0.410 | 2e-90 | |
| 359490833 | 688 | PREDICTED: two-component response regula | 0.690 | 0.492 | 0.531 | 3e-89 |
| >gi|302143985|emb|CBI23090.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 520 bits (1338), Expect = e-144, Method: Compositional matrix adjust.
Identities = 286/502 (56%), Positives = 340/502 (67%), Gaps = 13/502 (2%)
Query: 1 MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQSSMVSGNETQDESVGQQK 60
MSS S++TVYKCM+RGAAD+LVKPVRRNEL+NLWQHVWRRQSS VSGN QDESV QQK
Sbjct: 121 MSSHGSINTVYKCMLRGAADFLVKPVRRNELKNLWQHVWRRQSSTVSGNGPQDESVAQQK 180
Query: 61 IEATSENDAASNHSSGYMACIQSKGEFIEKGSDEQSSCTKPDFEAESAHVEDMPDLSRQL 120
+EATSEN+ SNHSS ++ACIQ E + K SD QSSC+KPD EAESA++E M D S
Sbjct: 181 VEATSENNPTSNHSSDHVACIQKNKEALNKVSDAQSSCSKPDLEAESAYMETMQDFSNPT 240
Query: 121 WGKSLQNDVKMQNHEARVNYGQKSLVPVTEAQGSEVAACKEANTRAHFDEDTELETHRSD 180
W +SL +D KMQ +E G K L+ EA G+ AAC++ NT E E E
Sbjct: 241 WSRSLVSDTKMQKNEECAKLGPKFLMHNKEAGGTLEAACRDVNTMTQ-PEAVEPENDGQG 299
Query: 181 VILTSEVCN---VPVNSPRQVIDFMSAFNNHKP------PSNNGASRFDSSPQLDLSLRR 231
SE C + +S R+ ID + F+N K SNNG + DS PQLDLSLRR
Sbjct: 300 ANAPSEACGNNAILGSSSREAIDLIGVFDNSKKCTYGNSSSNNGTKKSDSIPQLDLSLRR 359
Query: 232 THPDGFENQV-ERKFILRHSNASAFTRYTNKPSEPQHSSLSGVCNQQKEFETDSEKNFSN 290
+HP ENQV + + L HSN SAF+RY N+ +P H +GV NQQK F DS+K S
Sbjct: 360 SHPSSPENQVADERHTLNHSNGSAFSRYINRSLQPPHLPSTGVFNQQKNFGADSDKRLSQ 419
Query: 291 ILTACNSYTPAATLSTQRSVNSLATGHSKQSELAVSYPQQRPCPVPVSVKV-NSTNQAMH 349
++T NS + TLSTQRSV SLAT S + E+A+ PQQR P PV NST+Q H
Sbjct: 420 LVTGYNSDITSPTLSTQRSVISLATSPSGRVEIALCGPQQRAFPAPVPQNANNSTSQTNH 479
Query: 350 KLDHKLDSLEDLGHISPATDQSASSSFCNGAVSRLNSMGYGSACGSNSNLDQVTAGRAAA 409
K +HKLDSLE GH SPATDQ++SSSF NG S LNS G GS CGSN N + V +AAA
Sbjct: 480 KPEHKLDSLEGQGHFSPATDQNSSSSFGNGGASNLNSFGCGSICGSNGNANTVAVVQAAA 539
Query: 410 ESKNEEGLFPSNGN-LRSIQREAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQF 468
E KNEEG+F G+ RSIQREAAL KFRLKRKDRC++KKVRYESRKKLAEQRPRVKGQF
Sbjct: 540 EGKNEEGIFSHEGHSQRSIQREAALTKFRLKRKDRCFEKKVRYESRKKLAEQRPRVKGQF 599
Query: 469 VRQVHSETLPLESENHSGNISD 490
VRQVH+ P E + + G+ D
Sbjct: 600 VRQVHTIPPPAEPDTYYGSSFD 621
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|157399680|gb|ABV53464.1| pseudo-response regulator 5 [Castanea sativa] | Back alignment and taxonomy information |
|---|
| >gi|224132554|ref|XP_002321349.1| pseudo response regulator [Populus trichocarpa] gi|222868345|gb|EEF05476.1| pseudo response regulator [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356518667|ref|XP_003528000.1| PREDICTED: two-component response regulator-like PRR95-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356509155|ref|XP_003523317.1| PREDICTED: two-component response regulator-like APRR9-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357464211|ref|XP_003602387.1| Two-component response regulator-like PRR73 [Medicago truncatula] gi|355491435|gb|AES72638.1| Two-component response regulator-like PRR73 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449497396|ref|XP_004160390.1| PREDICTED: two-component response regulator-like PRR95-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224132558|ref|XP_002321351.1| response regulator [Populus trichocarpa] gi|222868347|gb|EEF05478.1| response regulator [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449456441|ref|XP_004145958.1| PREDICTED: two-component response regulator-like PRR95-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359490833|ref|XP_003634174.1| PREDICTED: two-component response regulator-like APRR5-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 491 | ||||||
| TAIR|locus:2044376 | 468 | PRR9 "pseudo-response regulato | 0.162 | 0.170 | 0.621 | 6.1e-39 | |
| TAIR|locus:2151206 | 727 | PRR7 "pseudo-response regulato | 0.221 | 0.149 | 0.467 | 2.4e-32 | |
| TAIR|locus:2163198 | 618 | TOC1 "TIMING OF CAB EXPRESSION | 0.128 | 0.101 | 0.539 | 1.3e-21 | |
| TAIR|locus:2062749 | 183 | AT2G46670 "AT2G46670" [Arabido | 0.162 | 0.437 | 0.621 | 3.5e-20 | |
| TAIR|locus:2143206 | 373 | CO "CONSTANS" [Arabidopsis tha | 0.105 | 0.139 | 0.471 | 4.7e-07 | |
| TAIR|locus:2093668 | 690 | RR1 "response regulator 1" [Ar | 0.334 | 0.237 | 0.301 | 5.1e-07 | |
| TAIR|locus:2074587 | 347 | COL2 "CONSTANS-like 2" [Arabid | 0.105 | 0.149 | 0.461 | 7e-07 | |
| TAIR|locus:2172545 | 355 | COL5 "CONSTANS-like 5" [Arabid | 0.260 | 0.360 | 0.326 | 3.5e-06 | |
| TAIR|locus:2130095 | 664 | RR2 "response regulator 2" [Ar | 0.205 | 0.152 | 0.357 | 4.5e-06 | |
| TAIR|locus:2007482 | 195 | AT1G07050 "AT1G07050" [Arabido | 0.095 | 0.241 | 0.446 | 6.2e-06 |
| TAIR|locus:2044376 PRR9 "pseudo-response regulator 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 227 (85.0 bits), Expect = 6.1e-39, Sum P(3) = 6.1e-39
Identities = 51/82 (62%), Positives = 62/82 (75%)
Query: 394 GSNSNLDQVTAGRAAAESKNEEGLFPSNGNLRSIQREAALNKFRLKRKDRCYDKKVRYES 453
GS S + + AG++++ K +E RS QREAAL KFRLKRKDRC+DKKVRY+S
Sbjct: 384 GSQSTNEGI-AGQSSSTEKPKEEESAKQRWSRS-QREAALMKFRLKRKDRCFDKKVRYQS 441
Query: 454 RKKLAEQRPRVKGQFVRQVHSE 475
RKKLAEQRPRVKGQFVR V+S+
Sbjct: 442 RKKLAEQRPRVKGQFVRTVNSD 463
|
|
| TAIR|locus:2151206 PRR7 "pseudo-response regulator 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163198 TOC1 "TIMING OF CAB EXPRESSION 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2062749 AT2G46670 "AT2G46670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143206 CO "CONSTANS" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074587 COL2 "CONSTANS-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2172545 COL5 "CONSTANS-like 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130095 RR2 "response regulator 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2007482 AT1G07050 "AT1G07050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| PtpRR3 | response regulator (687 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| ETR7 | • | 0.681 | |||||||||
| gw1.I.396.1 | • | 0.679 | |||||||||
| fgenesh4_pg.C_scaffold_697000003 | • | 0.679 | |||||||||
| fgenesh4_pg.C_LG_XIV000773 | • | 0.679 | |||||||||
| fgenesh4_pg.C_LG_X002318 | • | 0.679 | |||||||||
| fgenesh4_pg.C_LG_VI001633 | • | 0.679 | |||||||||
| fgenesh4_pg.C_LG_IX000220 | • | 0.679 | |||||||||
| fgenesh4_pg.C_LG_I003334 | • | 0.679 | |||||||||
| eugene3.00440046 | • | 0.679 | |||||||||
| eugene3.00180254 | • | 0.679 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 491 | |||
| pfam06203 | 45 | pfam06203, CCT, CCT motif | 4e-19 | |
| cd00156 | 113 | cd00156, REC, Signal receiver domain; originally t | 5e-04 | |
| pfam00072 | 111 | pfam00072, Response_reg, Response regulator receiv | 0.004 |
| >gnl|CDD|203407 pfam06203, CCT, CCT motif | Back alignment and domain information |
|---|
Score = 80.3 bits (199), Expect = 4e-19
Identities = 28/43 (65%), Positives = 36/43 (83%)
Query: 429 REAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQFVRQ 471
REAAL +++ KRK R +DKK+RY SRK +AE RPRVKG+FV+Q
Sbjct: 1 REAALLRYKEKRKTRKFDKKIRYASRKAVAESRPRVKGRFVKQ 43
|
This short motif is found in a number of plant proteins. It is rich in basic amino acids and has been called a CCT motif after Co, Col and Toc1. The CCT motif is about 45 amino acids long and contains a putative nuclear localisation signal within the second half of the CCT motif. Toc1 mutants have been identified in this region. Length = 45 |
| >gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 491 | |||
| PF06203 | 45 | CCT: CCT motif; InterPro: IPR010402 The CCT (CONST | 99.74 | |
| COG4753 | 475 | Response regulator containing CheY-like receiver d | 98.3 | |
| COG4566 | 202 | TtrR Response regulator [Signal transduction mecha | 97.62 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 97.55 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 97.49 | |
| COG0745 | 229 | OmpR Response regulators consisting of a CheY-like | 97.28 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 96.96 | |
| COG4567 | 182 | Response regulator consisting of a CheY-like recei | 96.85 | |
| PLN03029 | 222 | type-a response regulator protein; Provisional | 96.73 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 96.44 | |
| PRK10529 | 225 | DNA-binding transcriptional activator KdpE; Provis | 96.39 | |
| PRK10643 | 222 | DNA-binding transcriptional regulator BasR; Provis | 96.28 | |
| TIGR03787 | 227 | marine_sort_RR proteobacterial dedicated sortase s | 96.28 | |
| PRK10766 | 221 | DNA-binding transcriptional regulator TorR; Provis | 96.26 | |
| PRK10336 | 219 | DNA-binding transcriptional regulator QseB; Provis | 96.19 | |
| PRK10161 | 229 | transcriptional regulator PhoB; Provisional | 96.15 | |
| PRK11173 | 237 | two-component response regulator; Provisional | 96.12 | |
| PRK09836 | 227 | DNA-binding transcriptional activator CusR; Provis | 96.1 | |
| PRK10816 | 223 | DNA-binding transcriptional regulator PhoP; Provis | 96.08 | |
| CHL00148 | 240 | orf27 Ycf27; Reviewed | 96.0 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 95.91 | |
| TIGR02154 | 226 | PhoB phosphate regulon transcriptional regulatory | 95.87 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 95.86 | |
| PF09425 | 27 | CCT_2: Divergent CCT motif; InterPro: IPR018467 Th | 95.8 | |
| PRK10955 | 232 | DNA-binding transcriptional regulator CpxR; Provis | 95.79 | |
| PRK10693 | 303 | response regulator of RpoS; Provisional | 95.78 | |
| PRK09468 | 239 | ompR osmolarity response regulator; Provisional | 95.78 | |
| PRK10610 | 129 | chemotaxis regulatory protein CheY; Provisional | 95.76 | |
| PRK10360 | 196 | DNA-binding transcriptional activator UhpA; Provis | 95.65 | |
| PRK11517 | 223 | transcriptional regulatory protein YedW; Provision | 95.64 | |
| TIGR01387 | 218 | cztR_silR_copR heavy metal response regulator. Mem | 95.58 | |
| PRK11083 | 228 | DNA-binding response regulator CreB; Provisional | 95.54 | |
| PRK09958 | 204 | DNA-binding transcriptional activator EvgA; Provis | 95.47 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 95.42 | |
| TIGR02875 | 262 | spore_0_A sporulation transcription factor Spo0A. | 95.34 | |
| KOG1601 | 340 | consensus GATA-4/5/6 transcription factors [Transc | 95.33 | |
| PRK10701 | 240 | DNA-binding transcriptional regulator RstA; Provis | 95.31 | |
| PRK13856 | 241 | two-component response regulator VirG; Provisional | 95.28 | |
| PRK09935 | 210 | transcriptional regulator FimZ; Provisional | 95.17 | |
| PRK11697 | 238 | putative two-component response-regulatory protein | 95.1 | |
| PRK15479 | 221 | transcriptional regulatory protein TctD; Provision | 95.02 | |
| PRK14084 | 246 | two-component response regulator; Provisional | 94.88 | |
| PRK10710 | 240 | DNA-binding transcriptional regulator BaeR; Provis | 94.58 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 94.48 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 94.24 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 94.24 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 94.19 | |
| PRK09483 | 217 | response regulator; Provisional | 94.14 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 93.98 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 93.97 | |
| COG0784 | 130 | CheY FOG: CheY-like receiver [Signal transduction | 93.66 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 93.65 | |
| PRK10403 | 215 | transcriptional regulator NarP; Provisional | 93.65 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 93.6 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 93.52 | |
| COG3437 | 360 | Response regulator containing a CheY-like receiver | 93.48 | |
| PRK13435 | 145 | response regulator; Provisional | 93.47 | |
| COG3707 | 194 | AmiR Response regulator with putative antiterminat | 93.26 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 93.02 | |
| PRK10651 | 216 | transcriptional regulator NarL; Provisional | 92.58 | |
| PRK15347 | 921 | two component system sensor kinase SsrA; Provision | 92.43 | |
| PRK11466 | 914 | hybrid sensory histidine kinase TorS; Provisional | 91.78 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 91.67 | |
| cd00156 | 113 | REC Signal receiver domain; originally thought to | 91.59 | |
| PRK09390 | 202 | fixJ response regulator FixJ; Provisional | 91.1 | |
| TIGR02956 | 968 | TMAO_torS TMAO reductase sytem sensor TorS. This p | 90.57 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 89.69 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 87.93 | |
| PRK12555 | 337 | chemotaxis-specific methylesterase; Provisional | 86.55 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 85.41 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 82.86 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 81.21 |
| >PF06203 CCT: CCT motif; InterPro: IPR010402 The CCT (CONSTANS, CO-like, and TOC1) domain is a highly conserved basic module of ~43 amino acids, which is found near the C terminus of plant proteins often involved in light signal transduction | Back alignment and domain information |
|---|
Probab=99.74 E-value=7.6e-19 Score=132.47 Aligned_cols=45 Identities=56% Similarity=0.986 Sum_probs=43.1
Q ss_pred HHHHHHHHHHhhhccCCCCcccchhhhhhhhhCCCCCcceecccC
Q 011217 429 REAALNKFRLKRKDRCYDKKVRYESRKKLAEQRPRVKGQFVRQVH 473 (491)
Q Consensus 429 R~~~l~ryr~Krk~R~f~KkirY~~RK~~A~~RpRvKGrFvk~~~ 473 (491)
|+++|+||++||+.|+|+|+|+|+|||.+|+.|||||||||+..+
T Consensus 1 R~~~l~Ry~~Kr~~R~f~kkirY~~Rk~~A~~R~RvkGRFvk~~e 45 (45)
T PF06203_consen 1 REEKLQRYREKRKRRNFEKKIRYESRKAVADKRPRVKGRFVKKSE 45 (45)
T ss_pred CHHHHHHHHHHHHhhcccccCCcchHHHHHhhCCccCCcccCCCC
Confidence 689999999999999999999999999999999999999999764
|
The CCT domain is found in association with other domains, such as the B-box zinc finger, the GATA-type zinc finger, the ZIM motif or the response regulatory domain. The CCT domain contains a putative nuclear localisation signal within the second half of the CCT motif and has been shown to be involved in nuclear localization and probably also has a role in protein-protein interaction [].; GO: 0005515 protein binding |
| >COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4566 TtrR Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PLN03029 type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >PRK10529 DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >PRK10643 DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
| >PRK10766 DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >PRK10336 DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >PRK10161 transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >PRK11173 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09836 DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >PRK10816 DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >CHL00148 orf27 Ycf27; Reviewed | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PF09425 CCT_2: Divergent CCT motif; InterPro: IPR018467 The short CCT (CO, COL, TOC1) motif is found in a number of plant proteins, including Constans (CO), Constans-like (COL) and TOC1 | Back alignment and domain information |
|---|
| >PRK10955 DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >PRK10693 response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >PRK09468 ompR osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10610 chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >PRK10360 DNA-binding transcriptional activator UhpA; Provisional | Back alignment and domain information |
|---|
| >PRK11517 transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >TIGR01387 cztR_silR_copR heavy metal response regulator | Back alignment and domain information |
|---|
| >PRK11083 DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >PRK09958 DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >TIGR02875 spore_0_A sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >KOG1601 consensus GATA-4/5/6 transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PRK10701 DNA-binding transcriptional regulator RstA; Provisional | Back alignment and domain information |
|---|
| >PRK13856 two-component response regulator VirG; Provisional | Back alignment and domain information |
|---|
| >PRK09935 transcriptional regulator FimZ; Provisional | Back alignment and domain information |
|---|
| >PRK11697 putative two-component response-regulatory protein YehT; Provisional | Back alignment and domain information |
|---|
| >PRK15479 transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >PRK14084 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10710 DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK10403 transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
| >COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13435 response regulator; Provisional | Back alignment and domain information |
|---|
| >COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >PRK10651 transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >PRK15347 two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >PRK11466 hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >PRK09390 fixJ response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PRK12555 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 491 | |||
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 8e-05 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 7e-04 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 7e-04 |
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 | Back alignment and structure |
|---|
Score = 41.6 bits (98), Expect = 8e-05
Identities = 8/43 (18%), Positives = 17/43 (39%)
Query: 1 MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQS 43
+++ S T+ M G D L P+ L + + + +
Sbjct: 101 VTTDASSQTLLDAMRAGVRDVLRWPLEPRALDDALKRAAAQCA 143
|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 491 | |||
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 97.62 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 97.59 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 97.58 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 97.58 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 97.55 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 97.55 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 97.55 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 97.54 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 97.52 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 97.49 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 97.49 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 97.49 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 97.48 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 97.48 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 97.46 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 97.46 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 97.44 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 97.43 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 97.43 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 97.41 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 97.4 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 97.4 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 97.39 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 97.39 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 97.38 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 97.36 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 97.34 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 97.34 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 97.32 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 97.32 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 97.31 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 97.3 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 97.29 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 97.29 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 97.24 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 97.23 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 97.23 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 97.2 | |
| 3r0j_A | 250 | Possible two component system response transcript | 97.2 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 97.2 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 97.18 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 97.18 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 97.16 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 97.15 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 97.13 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 97.13 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 97.12 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 97.1 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 97.09 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 97.09 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 97.08 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 97.07 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 97.06 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 97.06 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 97.06 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 97.05 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 97.01 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 97.01 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 96.97 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 96.95 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 96.94 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 96.91 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 96.91 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 96.89 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 96.88 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 96.86 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 96.86 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 96.85 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 96.85 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 96.85 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 96.82 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 96.8 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 96.79 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 96.79 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 96.78 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 96.78 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 96.74 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 96.65 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 96.65 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 96.64 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 96.45 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 96.41 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 96.4 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 96.38 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 96.03 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 95.82 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 95.74 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 95.47 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 94.71 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 94.6 | |
| 3ogl_Q | 21 | JAZ1 incomplete degron peptide; leucine-rich repea | 94.52 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 94.51 | |
| 2lpm_A | 123 | Two-component response regulator; transcription re | 93.96 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 93.61 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 93.52 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 93.47 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 93.4 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 92.67 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 92.09 | |
| 3ogk_Q | 22 | JAZ1 incomplete degron peptide; leucine rich repea | 91.54 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 88.95 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 83.88 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 80.84 |
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A | Back alignment and structure |
|---|
Probab=97.62 E-value=6.3e-05 Score=60.61 Aligned_cols=42 Identities=26% Similarity=0.434 Sum_probs=38.3
Q ss_pred CCCcchHHHHHHHHHhccceeEeCCCCHHHHHHHHHHHHHHH
Q 011217 1 MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQ 42 (491)
Q Consensus 1 MS~~d~~e~v~kal~~GA~DYLlKPv~~eELk~lwqhv~rk~ 42 (491)
||++.+.+.+.+|+..||.|||.||++.++|...++.++++.
T Consensus 78 ~s~~~~~~~~~~~~~~g~~~~l~kp~~~~~l~~~i~~~~~~~ 119 (121)
T 2pl1_A 78 LTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRN 119 (121)
T ss_dssp EESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred EecCCCHHHHHHHHHcCccceEECCCCHHHHHHHHHHHHHhh
Confidence 467888899999999999999999999999999999988764
|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >3ogk_Q JAZ1 incomplete degron peptide; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 491 | ||||
| d1jbea_ | 128 | c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI | 7e-06 | |
| d2a9pa1 | 117 | c.23.1.1 (A:2-118) DNA-binding response regulator | 7e-06 | |
| d1zesa1 | 121 | c.23.1.1 (A:3-123) PhoB receiver domain {Escherich | 8e-06 | |
| d1k66a_ | 149 | c.23.1.1 (A:) Response regulator for cyanobacteria | 8e-06 | |
| d1k68a_ | 140 | c.23.1.1 (A:) Response regulator for cyanobacteria | 1e-05 | |
| d1zh2a1 | 119 | c.23.1.1 (A:2-120) Transcriptional regulatory prot | 1e-05 | |
| d1ys7a2 | 121 | c.23.1.1 (A:7-127) Transcriptional regulatory prot | 2e-05 | |
| d2pl1a1 | 119 | c.23.1.1 (A:1-119) PhoP receiver domain {Escherich | 3e-05 | |
| d1mb3a_ | 123 | c.23.1.1 (A:) Cell division response regulator Div | 3e-05 | |
| d1kgsa2 | 122 | c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog | 4e-05 | |
| d1dz3a_ | 123 | c.23.1.1 (A:) Sporulation response regulator Spo0A | 4e-05 | |
| d1xhfa1 | 121 | c.23.1.1 (A:2-122) Aerobic respiration control pro | 5e-05 | |
| d1mvoa_ | 121 | c.23.1.1 (A:) PhoP receiver domain {Bacillus subti | 5e-05 | |
| d1zgza1 | 120 | c.23.1.1 (A:2-121) TorCAD operon transcriptional r | 5e-05 | |
| d1ny5a1 | 137 | c.23.1.1 (A:1-137) Transcriptional activator sigm5 | 7e-05 | |
| d1dcfa_ | 134 | c.23.1.2 (A:) Receiver domain of the ethylene rece | 7e-05 | |
| d1i3ca_ | 144 | c.23.1.1 (A:) Response regulator for cyanobacteria | 1e-04 | |
| d1p2fa2 | 120 | c.23.1.1 (A:1-120) Response regulator DrrB {Thermo | 1e-04 | |
| d1p6qa_ | 129 | c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti | 1e-04 | |
| d2ayxa1 | 133 | c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C | 2e-04 | |
| d1dbwa_ | 123 | c.23.1.1 (A:) Transcriptional regulatory protein F | 2e-04 | |
| d1krwa_ | 123 | c.23.1.1 (A:) NTRC receiver domain {Salmonella typ | 2e-04 | |
| d1yioa2 | 128 | c.23.1.1 (A:3-130) Response regulatory protein Sty | 2e-04 | |
| d1a04a2 | 138 | c.23.1.1 (A:5-142) Nitrate/nitrite response regula | 3e-04 | |
| d2r25b1 | 128 | c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba | 3e-04 | |
| d1qkka_ | 140 | c.23.1.1 (A:) Transcriptional regulatory protein D | 6e-04 | |
| d1u0sy_ | 118 | c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T | 6e-04 | |
| d1w25a1 | 139 | c.23.1.1 (A:2-140) Response regulator PleD, receiv | 7e-04 | |
| d1peya_ | 119 | c.23.1.1 (A:) Sporulation response regulator Spo0F | 0.001 | |
| d1w25a2 | 153 | c.23.1.1 (A:141-293) Response regulator PleD, rece | 0.001 |
| >d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} Length = 128 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: CheY-like family: CheY-related domain: CheY protein species: Escherichia coli [TaxId: 562]
Score = 43.4 bits (102), Expect = 7e-06
Identities = 7/41 (17%), Positives = 17/41 (41%)
Query: 1 MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRR 41
++++ + GA+ Y+VKP L ++ +
Sbjct: 85 VTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK 125
|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 491 | |||
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 98.24 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 98.22 | |
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 98.22 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 98.2 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 98.18 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 98.16 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 98.16 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 98.15 | |
| d1qo0d_ | 189 | Positive regulator of the amidase operon AmiR {Pse | 98.12 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 98.12 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 98.12 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 98.11 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 98.09 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 98.05 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 98.04 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 98.0 | |
| d1dz3a_ | 123 | Sporulation response regulator Spo0A {Bacillus ste | 97.97 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 97.95 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 97.94 | |
| d1s8na_ | 190 | Probable two-component system transcriptional regu | 97.93 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 97.93 | |
| d1yioa2 | 128 | Response regulatory protein StyR, N-terminal domai | 97.93 | |
| d1w25a2 | 153 | Response regulator PleD, receiver domain {Caulobac | 97.92 | |
| d1p6qa_ | 129 | CheY protein {Sinorhizobium meliloti, CheY2 [TaxId | 97.89 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 97.84 | |
| d1k68a_ | 140 | Response regulator for cyanobacterial phytochrome | 97.8 | |
| d2r25b1 | 128 | Response regulator Sin1 {Baker's yeast (Saccharomy | 97.76 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 97.74 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 97.73 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 97.6 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 97.59 | |
| d1a2oa1 | 140 | Methylesterase CheB, N-terminal domain {Salmonella | 95.83 | |
| d2b4aa1 | 118 | Hypothetical protein BH3024 {Bacillus halodurans [ | 93.19 |
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: CheY-like family: CheY-related domain: Transcriptional regulatory protein DctD, receiver domain species: Sinorhizobium meliloti [TaxId: 382]
Probab=98.24 E-value=4.1e-07 Score=78.11 Aligned_cols=42 Identities=14% Similarity=0.332 Sum_probs=39.6
Q ss_pred CCCcchHHHHHHHHHhccceeEeCCCCHHHHHHHHHHHHHHH
Q 011217 1 MSSQDSVSTVYKCMMRGAADYLVKPVRRNELRNLWQHVWRRQ 42 (491)
Q Consensus 1 MS~~d~~e~v~kal~~GA~DYLlKPv~~eELk~lwqhv~rk~ 42 (491)
||++++++++.+|++.||.|||+|||+.++|...+++++++.
T Consensus 78 lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~~~~~ 119 (140)
T d1qkka_ 78 VTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAEEKR 119 (140)
T ss_dssp EECGGGHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHHHHH
T ss_pred EECCCCHHHHHHHHHcCCCEeecCCCCHHHHHHHHHHHHHHH
Confidence 689999999999999999999999999999999999987665
|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|