Query         011221
Match_columns 490
No_of_seqs    167 out of 715
Neff          4.6 
Searched_HMMs 46136
Date          Thu Mar 28 22:56:39 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/011221.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/011221hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02597 phosphoenolpyruvate c 100.0  2E-130  5E-135 1035.1  35.7  380  102-489     1-401 (555)
  2 PTZ00311 phosphoenolpyruvate c 100.0  1E-125  3E-130 1004.0  34.5  357  131-489    31-411 (561)
  3 cd00484 PEPCK_ATP Phosphoenolp 100.0  1E-125  3E-130  998.6  32.5  345  143-489     2-364 (508)
  4 TIGR00224 pckA phosphoenolpyru 100.0  3E-125  7E-130  994.8  33.1  355  132-489     8-388 (532)
  5 COG1866 PckA Phosphoenolpyruva 100.0  8E-122  2E-126  948.8  25.2  354  133-489     9-381 (529)
  6 PF01293 PEPCK_ATP:  Phosphoeno 100.0  2E-116  5E-121  927.2  28.5  346  142-489     2-365 (466)
  7 PRK09344 phosphoenolpyruvate c 100.0  1E-114  2E-119  921.3  32.8  353  134-489     8-379 (526)
  8 cd01919 PEPCK Phosphoenolpyruv 100.0 3.1E-99  7E-104  804.0  32.1  345  143-489     2-372 (515)
  9 cd00819 PEPCK_GTP Phosphoenolp  99.9 1.3E-23 2.7E-28  225.1  23.5  319  140-468    13-412 (579)
 10 PRK04210 phosphoenolpyruvate c  99.9 2.8E-22   6E-27  215.2  22.7  323  140-468    25-426 (601)
 11 PF00821 PEPCK:  Phosphoenolpyr  99.9 4.8E-21   1E-25  206.1  18.8  325  140-474    11-419 (586)
 12 COG1274 PckA Phosphoenolpyruva  99.7 1.3E-16 2.9E-21  168.3  17.4  324  140-465    32-431 (608)
 13 KOG3749 Phosphoenolpyruvate ca  99.0 1.2E-09 2.6E-14  115.9  11.6  240  209-460   155-459 (640)
 14 cd01918 HprK_C HprK/P, the bif  98.0 3.8E-06 8.3E-11   78.1   2.5   45  322-367     3-50  (149)
 15 cd00820 PEPCK_HprK Phosphoenol  97.7 8.9E-06 1.9E-10   71.9   0.2   50  320-369     1-53  (107)
 16 PF07475 Hpr_kinase_C:  HPr Ser  97.7 2.3E-05 4.9E-10   74.6   2.5   46  321-367     6-54  (171)
 17 TIGR00679 hpr-ser Hpr(Ser) kin  97.5 5.2E-05 1.1E-09   77.9   2.8   73  292-367   106-182 (304)
 18 PRK05428 HPr kinase/phosphoryl  97.3 0.00014 2.9E-09   75.1   2.7   46  321-367   134-182 (308)
 19 COG1493 HprK Serine kinase of   97.3 0.00018   4E-09   73.8   3.1   74  292-368   105-182 (308)
 20 PRK06217 hypothetical protein;  95.3   0.011 2.3E-07   55.4   2.4   35  336-370     3-41  (183)
 21 PF13207 AAA_17:  AAA domain; P  95.0   0.011 2.4E-07   50.6   1.4   17  336-352     1-17  (121)
 22 PF13555 AAA_29:  P-loop contai  94.7   0.019 4.1E-07   46.4   1.8   21  331-351    20-40  (62)
 23 smart00382 AAA ATPases associa  94.6   0.016 3.4E-07   48.1   1.4   19  334-352     2-20  (148)
 24 COG0396 sufC Cysteine desulfur  94.5   0.032 6.8E-07   56.1   3.3   21  332-352    28-48  (251)
 25 PRK07261 topology modulation p  94.5   0.023   5E-07   53.1   2.3   32  336-367     2-37  (171)
 26 PF13671 AAA_33:  AAA domain; P  94.4   0.018   4E-07   50.4   1.4   17  336-352     1-17  (143)
 27 COG4148 ModC ABC-type molybdat  94.3   0.046   1E-06   56.7   4.0   32  319-352    10-42  (352)
 28 COG1136 SalX ABC-type antimicr  94.2   0.023 4.9E-07   56.6   1.8   21  332-352    29-49  (226)
 29 KOG3354 Gluconate kinase [Carb  94.2   0.026 5.6E-07   54.0   1.9   36  330-365     8-48  (191)
 30 COG0529 CysC Adenylylsulfate k  94.2   0.021 4.6E-07   55.4   1.3   21  332-352    21-41  (197)
 31 COG0542 clpA ATP-binding subun  94.1   0.014   3E-07   66.9  -0.0   87  336-425   523-642 (786)
 32 COG3839 MalK ABC-type sugar tr  94.0   0.025 5.5E-07   59.3   1.8   21  332-352    27-47  (338)
 33 PRK08118 topology modulation p  94.0   0.025 5.3E-07   52.9   1.5   32  336-367     3-38  (167)
 34 PF05673 DUF815:  Protein of un  94.0   0.012 2.7E-07   59.2  -0.6  136  335-478    53-203 (249)
 35 COG1126 GlnQ ABC-type polar am  94.0   0.028   6E-07   56.2   1.8   21  332-352    26-46  (240)
 36 cd03220 ABC_KpsT_Wzt ABC_KpsT_  94.0   0.048   1E-06   52.7   3.4   47  303-352    19-66  (224)
 37 TIGR01313 therm_gnt_kin carboh  93.8   0.026 5.6E-07   51.2   1.1   27  337-363     1-31  (163)
 38 KOG0058 Peptide exporter, ABC   93.7   0.015 3.2E-07   65.9  -0.8   66  334-410   494-566 (716)
 39 COG4136 ABC-type uncharacteriz  93.7   0.032 6.9E-07   53.5   1.5   21  332-352    26-46  (213)
 40 COG1125 OpuBA ABC-type proline  93.6   0.021 4.5E-07   58.4   0.1   56  332-387    25-88  (309)
 41 PRK09825 idnK D-gluconate kina  93.5   0.033 7.2E-07   52.5   1.4   20  333-352     2-21  (176)
 42 TIGR03263 guanyl_kin guanylate  93.5   0.035 7.5E-07   51.0   1.4   19  334-352     1-19  (180)
 43 COG4175 ProV ABC-type proline/  93.5   0.031 6.8E-07   58.6   1.2   21  332-352    52-72  (386)
 44 COG1116 TauB ABC-type nitrate/  93.4   0.039 8.5E-07   55.7   1.8   21  332-352    27-47  (248)
 45 COG1117 PstB ABC-type phosphat  93.4   0.038 8.3E-07   55.3   1.7   21  332-352    31-51  (253)
 46 PRK00300 gmk guanylate kinase;  93.4   0.039 8.4E-07   51.9   1.7   21  332-352     3-23  (205)
 47 TIGR02322 phosphon_PhnN phosph  93.3   0.037 8.1E-07   51.0   1.3   19  334-352     1-19  (179)
 48 PRK08233 hypothetical protein;  93.2   0.042 9.1E-07   50.1   1.5   19  334-352     3-21  (182)
 49 TIGR00235 udk uridine kinase.   93.1   0.037 8.1E-07   52.7   1.1   21  332-352     4-24  (207)
 50 PF01583 APS_kinase:  Adenylyls  93.1   0.036 7.8E-07   52.2   1.0   19  334-352     2-20  (156)
 51 cd00227 CPT Chloramphenicol (C  93.1   0.042 9.2E-07   50.9   1.4   19  334-352     2-20  (175)
 52 COG3840 ThiQ ABC-type thiamine  93.0    0.06 1.3E-06   53.0   2.2   32  320-352    12-43  (231)
 53 PF13238 AAA_18:  AAA domain; P  93.0   0.044 9.5E-07   46.6   1.2   16  337-352     1-16  (129)
 54 COG4181 Predicted ABC-type tra  92.9   0.038 8.2E-07   53.9   0.8   41  332-372    34-83  (228)
 55 PRK11174 cysteine/glutathione   92.8   0.018   4E-07   62.9  -1.8   21  332-352   374-394 (588)
 56 PRK10078 ribose 1,5-bisphospho  92.7   0.054 1.2E-06   50.8   1.5   19  334-352     2-20  (186)
 57 PRK05541 adenylylsulfate kinas  92.7   0.056 1.2E-06   49.9   1.6   21  332-352     5-25  (176)
 58 cd03238 ABC_UvrA The excision   92.7   0.061 1.3E-06   51.1   1.8   21  332-352    19-39  (176)
 59 PRK00131 aroK shikimate kinase  92.6   0.059 1.3E-06   48.5   1.5   19  334-352     4-22  (175)
 60 PRK00889 adenylylsulfate kinas  92.4   0.062 1.3E-06   49.6   1.4   21  332-352     2-22  (175)
 61 PRK05480 uridine/cytidine kina  92.4   0.065 1.4E-06   50.9   1.5   21  332-352     4-24  (209)
 62 PF00005 ABC_tran:  ABC transpo  92.4   0.076 1.7E-06   46.4   1.9   21  332-352     9-29  (137)
 63 TIGR03797 NHPM_micro_ABC2 NHPM  92.3   0.025 5.4E-07   63.3  -1.6   21  332-352   477-497 (686)
 64 cd03225 ABC_cobalt_CbiO_domain  92.3   0.072 1.6E-06   50.4   1.7   21  332-352    25-45  (211)
 65 COG3842 PotA ABC-type spermidi  92.3   0.069 1.5E-06   56.4   1.7   21  332-352    29-49  (352)
 66 PF03193 DUF258:  Protein of un  92.2   0.079 1.7E-06   50.2   1.9   19  334-352    35-53  (161)
 67 PF00004 AAA:  ATPase family as  92.2    0.06 1.3E-06   46.0   1.0   16  337-352     1-16  (132)
 68 cd00009 AAA The AAA+ (ATPases   92.2   0.073 1.6E-06   44.8   1.5   20  333-352    18-37  (151)
 69 cd03270 ABC_UvrA_I The excisio  92.2   0.076 1.6E-06   51.7   1.8   20  332-351    19-38  (226)
 70 COG0563 Adk Adenylate kinase a  92.2   0.059 1.3E-06   51.4   1.0   17  336-352     2-18  (178)
 71 cd03255 ABC_MJ0796_Lo1CDE_FtsE  92.1    0.08 1.7E-06   50.3   1.8   21  332-352    28-48  (218)
 72 COG1118 CysA ABC-type sulfate/  92.1   0.099 2.1E-06   54.7   2.6   21  332-352    26-46  (345)
 73 TIGR01166 cbiO cobalt transpor  92.1   0.082 1.8E-06   49.4   1.8   21  332-352    16-36  (190)
 74 TIGR02673 FtsE cell division A  92.0   0.082 1.8E-06   50.1   1.8   21  332-352    26-46  (214)
 75 TIGR00960 3a0501s02 Type II (G  92.0   0.084 1.8E-06   50.2   1.8   21  332-352    27-47  (216)
 76 PRK06762 hypothetical protein;  91.9   0.071 1.5E-06   48.6   1.2   18  335-352     3-20  (166)
 77 cd03269 ABC_putative_ATPase Th  91.9   0.085 1.8E-06   50.0   1.8   21  332-352    24-44  (210)
 78 cd03265 ABC_DrrA DrrA is the A  91.9   0.088 1.9E-06   50.3   1.8   21  332-352    24-44  (220)
 79 TIGR02315 ABC_phnC phosphonate  91.8   0.088 1.9E-06   50.9   1.8   21  332-352    26-46  (243)
 80 COG4619 ABC-type uncharacteriz  91.8   0.078 1.7E-06   51.7   1.4   21  332-352    27-47  (223)
 81 TIGR02880 cbbX_cfxQ probable R  91.8   0.082 1.8E-06   53.6   1.6   48  303-352    29-76  (284)
 82 cd03226 ABC_cobalt_CbiO_domain  91.8   0.089 1.9E-06   49.7   1.8   21  332-352    24-44  (205)
 83 cd03262 ABC_HisP_GlnQ_permease  91.8   0.091   2E-06   49.7   1.8   21  332-352    24-44  (213)
 84 cd03260 ABC_PstB_phosphate_tra  91.8    0.09 1.9E-06   50.4   1.8   21  332-352    24-44  (227)
 85 COG4525 TauB ABC-type taurine   91.8   0.091   2E-06   52.3   1.8   21  332-352    29-49  (259)
 86 cd03292 ABC_FtsE_transporter F  91.8   0.091   2E-06   49.7   1.8   21  332-352    25-45  (214)
 87 cd03261 ABC_Org_Solvent_Resist  91.7   0.093   2E-06   50.7   1.8   21  332-352    24-44  (235)
 88 cd03219 ABC_Mj1267_LivG_branch  91.7   0.091   2E-06   50.6   1.7   21  332-352    24-44  (236)
 89 cd03257 ABC_NikE_OppD_transpor  91.7   0.094   2E-06   50.0   1.8   21  332-352    29-49  (228)
 90 cd03259 ABC_Carb_Solutes_like   91.6   0.096 2.1E-06   49.7   1.8   21  332-352    24-44  (213)
 91 COG1124 DppF ABC-type dipeptid  91.6   0.084 1.8E-06   53.3   1.5   21  332-352    31-51  (252)
 92 cd02019 NK Nucleoside/nucleoti  91.6    0.07 1.5E-06   42.7   0.7   16  337-352     2-17  (69)
 93 PRK10070 glycine betaine trans  91.6   0.082 1.8E-06   56.4   1.4   21  332-352    52-72  (400)
 94 cd03235 ABC_Metallic_Cations A  91.5   0.099 2.1E-06   49.6   1.8   21  332-352    23-43  (213)
 95 TIGR00958 3a01208 Conjugate Tr  91.5   0.028   6E-07   63.5  -2.3   21  332-352   505-525 (711)
 96 TIGR03796 NHPM_micro_ABC1 NHPM  91.5   0.032   7E-07   62.6  -1.8   21  332-352   503-523 (710)
 97 cd03263 ABC_subfamily_A The AB  91.5     0.1 2.2E-06   49.7   1.8   21  332-352    26-46  (220)
 98 TIGR03375 type_I_sec_LssB type  91.5   0.034 7.3E-07   62.4  -1.7   21  332-352   489-509 (694)
 99 cd03224 ABC_TM1139_LivF_branch  91.4   0.098 2.1E-06   49.8   1.6   21  332-352    24-44  (222)
100 cd03258 ABC_MetN_methionine_tr  91.4    0.11 2.3E-06   50.1   1.8   21  332-352    29-49  (233)
101 cd03268 ABC_BcrA_bacitracin_re  91.3    0.11 2.3E-06   49.2   1.8   21  332-352    24-44  (208)
102 TIGR02204 MsbA_rel ABC transpo  91.3    0.03 6.5E-07   61.0  -2.3   21  332-352   364-384 (576)
103 cd03293 ABC_NrtD_SsuB_transpor  91.3     0.1 2.2E-06   49.9   1.6   21  332-352    28-48  (220)
104 TIGR02211 LolD_lipo_ex lipopro  91.3    0.11 2.4E-06   49.5   1.8   21  332-352    29-49  (221)
105 cd03266 ABC_NatA_sodium_export  91.3    0.11 2.4E-06   49.4   1.8   21  332-352    29-49  (218)
106 TIGR03608 L_ocin_972_ABC putat  91.3    0.11 2.3E-06   49.0   1.7   21  332-352    22-42  (206)
107 COG2274 SunT ABC-type bacterio  91.2   0.044 9.6E-07   62.5  -1.1   21  332-352   497-517 (709)
108 TIGR03410 urea_trans_UrtE urea  91.2    0.11 2.4E-06   49.8   1.8   21  332-352    24-44  (230)
109 cd03256 ABC_PhnC_transporter A  91.2    0.11 2.4E-06   50.0   1.8   21  332-352    25-45  (241)
110 PF00485 PRK:  Phosphoribulokin  91.2     0.1 2.2E-06   49.3   1.4   17  336-352     1-17  (194)
111 TIGR02881 spore_V_K stage V sp  91.1    0.11 2.3E-06   51.6   1.6   43  303-352    13-60  (261)
112 PRK11124 artP arginine transpo  91.1    0.11 2.5E-06   50.3   1.8   21  332-352    26-46  (242)
113 COG4988 CydD ABC-type transpor  91.1   0.064 1.4E-06   59.6   0.0   21  332-352   345-365 (559)
114 TIGR01978 sufC FeS assembly AT  91.1    0.12 2.5E-06   50.0   1.8   21  332-352    24-44  (243)
115 cd03216 ABC_Carb_Monos_I This   91.1    0.12 2.5E-06   47.7   1.7   21  332-352    24-44  (163)
116 PRK03846 adenylylsulfate kinas  91.0     0.1 2.3E-06   49.4   1.4   21  332-352    22-42  (198)
117 cd03301 ABC_MalK_N The N-termi  91.0    0.12 2.6E-06   48.9   1.8   21  332-352    24-44  (213)
118 PF05496 RuvB_N:  Holliday junc  91.0   0.099 2.1E-06   52.4   1.2   18  335-352    51-68  (233)
119 cd03218 ABC_YhbG The ABC trans  91.0    0.12 2.6E-06   49.6   1.7   21  332-352    24-44  (232)
120 cd03214 ABC_Iron-Siderophores_  91.0    0.13 2.7E-06   48.0   1.8   21  332-352    23-43  (180)
121 PRK10908 cell division protein  90.9    0.12 2.7E-06   49.3   1.8   21  332-352    26-46  (222)
122 cd03230 ABC_DR_subfamily_A Thi  90.9    0.13 2.7E-06   47.7   1.7   21  332-352    24-44  (173)
123 TIGR01360 aden_kin_iso1 adenyl  90.9    0.11 2.5E-06   47.5   1.5   18  335-352     4-21  (188)
124 PRK15177 Vi polysaccharide exp  90.8    0.13 2.8E-06   49.6   1.8   21  332-352    11-31  (213)
125 PRK14738 gmk guanylate kinase;  90.8    0.12 2.5E-06   49.8   1.5   20  333-352    12-31  (206)
126 COG0194 Gmk Guanylate kinase [  90.8    0.11 2.5E-06   50.5   1.4   20  333-352     3-22  (191)
127 cd03229 ABC_Class3 This class   90.8    0.13 2.9E-06   47.7   1.8   21  332-352    24-44  (178)
128 cd03264 ABC_drug_resistance_li  90.8    0.12 2.5E-06   49.1   1.4   18  334-352    26-43  (211)
129 cd02021 GntK Gluconate kinase   90.8     0.1 2.2E-06   46.7   1.0   16  337-352     2-17  (150)
130 cd03222 ABC_RNaseL_inhibitor T  90.8    0.12 2.7E-06   49.0   1.6   21  332-352    23-43  (177)
131 PRK13540 cytochrome c biogenes  90.8    0.13 2.9E-06   48.5   1.8   21  332-352    25-45  (200)
132 PRK11629 lolD lipoprotein tran  90.7    0.13 2.8E-06   49.7   1.8   21  332-352    33-53  (233)
133 cd03246 ABCC_Protease_Secretio  90.7    0.14   3E-06   47.4   1.8   21  332-352    26-46  (173)
134 TIGR00150 HI0065_YjeE ATPase,   90.7    0.13 2.9E-06   47.2   1.7   21  332-352    20-40  (133)
135 PRK13539 cytochrome c biogenes  90.6    0.14   3E-06   48.8   1.8   21  332-352    26-46  (207)
136 PRK10584 putative ABC transpor  90.6    0.14   3E-06   49.2   1.8   21  332-352    34-54  (228)
137 cd03295 ABC_OpuCA_Osmoprotecti  90.6    0.14   3E-06   49.8   1.8   21  332-352    25-45  (242)
138 PRK14527 adenylate kinase; Pro  90.5    0.13 2.9E-06   48.3   1.6   20  333-352     5-24  (191)
139 PRK10895 lipopolysaccharide AB  90.5    0.14   3E-06   49.6   1.8   21  332-352    27-47  (241)
140 PRK13538 cytochrome c biogenes  90.5    0.14 3.1E-06   48.5   1.8   21  332-352    25-45  (204)
141 cd03296 ABC_CysA_sulfate_impor  90.5    0.14 3.1E-06   49.6   1.8   21  332-352    26-46  (239)
142 TIGR02323 CP_lyasePhnK phospho  90.5    0.13 2.9E-06   50.1   1.7   21  332-352    27-47  (253)
143 PRK14267 phosphate ABC transpo  90.5    0.14 3.1E-06   49.9   1.8   21  332-352    28-48  (253)
144 TIGR03864 PQQ_ABC_ATP ABC tran  90.5    0.14 3.1E-06   49.5   1.8   21  332-352    25-45  (236)
145 cd03254 ABCC_Glucan_exporter_l  90.5    0.15 3.2E-06   48.9   1.8   21  332-352    27-47  (229)
146 PF13479 AAA_24:  AAA domain     90.4    0.16 3.4E-06   49.1   2.1   28  334-361     3-30  (213)
147 PRK11248 tauB taurine transpor  90.4    0.14 3.1E-06   50.5   1.8   21  332-352    25-45  (255)
148 TIGR01359 UMP_CMP_kin_fam UMP-  90.4     0.1 2.2E-06   48.1   0.7   17  336-352     1-17  (183)
149 KOG0635 Adenosine 5'-phosphosu  90.4   0.085 1.8E-06   50.5   0.2   22  332-353    29-50  (207)
150 cd03223 ABCD_peroxisomal_ALDP   90.4    0.15 3.3E-06   47.1   1.8   21  332-352    25-45  (166)
151 PRK14247 phosphate ABC transpo  90.3    0.15 3.2E-06   49.7   1.8   21  332-352    27-47  (250)
152 cd02023 UMPK Uridine monophosp  90.3    0.11 2.5E-06   48.7   0.9   16  337-352     2-17  (198)
153 cd03245 ABCC_bacteriocin_expor  90.3    0.15 3.4E-06   48.5   1.8   21  332-352    28-48  (220)
154 cd03215 ABC_Carb_Monos_II This  90.3    0.15 3.3E-06   47.5   1.7   21  332-352    24-44  (182)
155 TIGR03265 PhnT2 putative 2-ami  90.3    0.15 3.2E-06   53.4   1.8   21  332-352    28-48  (353)
156 PF13401 AAA_22:  AAA domain; P  90.2    0.13 2.9E-06   44.2   1.2   21  332-352     2-22  (131)
157 PRK10744 pstB phosphate transp  90.2    0.15 3.3E-06   50.2   1.8   21  332-352    37-57  (260)
158 PRK14242 phosphate transporter  90.2    0.15 3.2E-06   49.8   1.7   21  332-352    30-50  (253)
159 cd03298 ABC_ThiQ_thiamine_tran  90.2    0.16 3.4E-06   48.2   1.8   21  332-352    22-42  (211)
160 TIGR00972 3a0107s01c2 phosphat  90.2    0.16 3.4E-06   49.6   1.8   21  332-352    25-45  (247)
161 TIGR01189 ccmA heme ABC export  90.2    0.16 3.4E-06   47.9   1.8   21  332-352    24-44  (198)
162 cd03221 ABCF_EF-3 ABCF_EF-3  E  90.1    0.17 3.6E-06   45.9   1.8   21  332-352    24-44  (144)
163 cd03247 ABCC_cytochrome_bd The  90.1    0.16 3.6E-06   47.0   1.8   21  332-352    26-46  (178)
164 PRK11264 putative amino-acid A  90.1    0.16 3.5E-06   49.4   1.8   21  332-352    27-47  (250)
165 PRK06547 hypothetical protein;  90.1    0.13 2.8E-06   48.6   1.2   17  336-352    17-33  (172)
166 cd02027 APSK Adenosine 5'-phos  90.1    0.11 2.4E-06   47.4   0.7   17  336-352     1-17  (149)
167 PRK14241 phosphate transporter  90.1    0.16 3.4E-06   50.0   1.7   21  332-352    28-48  (258)
168 PRK14255 phosphate ABC transpo  90.1    0.16 3.5E-06   49.5   1.8   21  332-352    29-49  (252)
169 PRK11247 ssuB aliphatic sulfon  90.0    0.16 3.5E-06   50.5   1.8   21  332-352    36-56  (257)
170 PRK14273 phosphate ABC transpo  90.0    0.16 3.5E-06   49.6   1.8   21  332-352    31-51  (254)
171 TIGR03771 anch_rpt_ABC anchore  90.0    0.16 3.6E-06   48.9   1.8   21  332-352     4-24  (223)
172 PF07728 AAA_5:  AAA domain (dy  90.0    0.14 3.1E-06   45.1   1.2   16  337-352     2-17  (139)
173 PRK03839 putative kinase; Prov  90.0    0.13 2.7E-06   47.7   0.9   17  336-352     2-18  (180)
174 PRK09183 transposase/IS protei  90.0    0.14 3.1E-06   51.2   1.4   20  333-352   101-120 (259)
175 TIGR01184 ntrCD nitrate transp  89.9    0.17 3.6E-06   49.1   1.8   21  332-352     9-29  (230)
176 PRK10247 putative ABC transpor  89.9    0.17 3.7E-06   48.8   1.8   21  332-352    31-51  (225)
177 cd00464 SK Shikimate kinase (S  89.9    0.13 2.9E-06   45.6   1.0   16  337-352     2-17  (154)
178 cd03231 ABC_CcmA_heme_exporter  89.9    0.17 3.7E-06   47.9   1.7   21  332-352    24-44  (201)
179 TIGR03005 ectoine_ehuA ectoine  89.9    0.17 3.7E-06   49.4   1.8   21  332-352    24-44  (252)
180 cd01120 RecA-like_NTPases RecA  89.8    0.12 2.6E-06   45.0   0.7   16  337-352     2-17  (165)
181 PRK13543 cytochrome c biogenes  89.8    0.18 3.8E-06   48.3   1.8   21  332-352    35-55  (214)
182 TIGR02324 CP_lyasePhnL phospho  89.8    0.18 3.8E-06   48.3   1.8   21  332-352    32-52  (224)
183 PRK13648 cbiO cobalt transport  89.8    0.17 3.7E-06   50.1   1.8   21  332-352    33-53  (269)
184 PRK14239 phosphate transporter  89.8    0.17 3.7E-06   49.2   1.8   21  332-352    29-49  (252)
185 PRK09493 glnQ glutamine ABC tr  89.8    0.17 3.8E-06   48.9   1.8   21  332-352    25-45  (240)
186 PRK10771 thiQ thiamine transpo  89.8    0.18 3.8E-06   48.7   1.8   21  332-352    23-43  (232)
187 TIGR02770 nickel_nikD nickel i  89.8    0.18 3.8E-06   48.8   1.8   21  332-352    10-30  (230)
188 cd03250 ABCC_MRP_domain1 Domai  89.8    0.18   4E-06   47.6   1.9   21  332-352    29-49  (204)
189 TIGR03411 urea_trans_UrtD urea  89.8    0.17 3.8E-06   48.9   1.8   21  332-352    26-46  (242)
190 TIGR03740 galliderm_ABC gallid  89.8    0.18 3.8E-06   48.3   1.8   21  332-352    24-44  (223)
191 PRK10575 iron-hydroxamate tran  89.7    0.18 3.9E-06   49.9   1.8   21  332-352    35-55  (265)
192 cd03252 ABCC_Hemolysin The ABC  89.7    0.18 3.9E-06   48.6   1.8   21  332-352    26-46  (237)
193 TIGR03238 dnd_assoc_3 dnd syst  89.7    0.17 3.7E-06   55.6   1.8   21  332-352    30-50  (504)
194 PRK14250 phosphate ABC transpo  89.7    0.18 3.9E-06   49.1   1.8   21  332-352    27-47  (241)
195 CHL00131 ycf16 sulfate ABC tra  89.7    0.18 3.9E-06   49.1   1.8   21  332-352    31-51  (252)
196 cd03249 ABC_MTABC3_MDL1_MDL2 M  89.7    0.19 4.1E-06   48.5   1.9   21  332-352    27-47  (238)
197 cd00071 GMPK Guanosine monopho  89.7    0.14 3.1E-06   46.2   0.9   16  337-352     2-17  (137)
198 cd03232 ABC_PDR_domain2 The pl  89.7    0.17 3.8E-06   47.6   1.6   21  332-352    31-51  (192)
199 cd03237 ABC_RNaseL_inhibitor_d  89.6    0.18   4E-06   49.8   1.8   21  332-352    23-43  (246)
200 cd03267 ABC_NatA_like Similar   89.6    0.27 5.9E-06   47.8   3.0   21  332-352    45-65  (236)
201 PRK11300 livG leucine/isoleuci  89.6    0.17 3.8E-06   49.3   1.6   21  332-352    29-49  (255)
202 PRK14274 phosphate ABC transpo  89.6    0.18   4E-06   49.5   1.8   21  332-352    36-56  (259)
203 PRK11432 fbpC ferric transport  89.6    0.18 3.9E-06   52.8   1.8   21  332-352    30-50  (351)
204 PRK14262 phosphate ABC transpo  89.6    0.18   4E-06   49.1   1.8   21  332-352    27-47  (250)
205 COG3638 ABC-type phosphate/pho  89.6    0.23 4.9E-06   50.4   2.4   21  332-352    28-48  (258)
206 PRK11831 putative ABC transpor  89.5    0.19   4E-06   50.0   1.8   21  332-352    31-51  (269)
207 PRK09452 potA putrescine/sperm  89.5    0.18 3.8E-06   53.4   1.7   21  332-352    38-58  (375)
208 PRK14530 adenylate kinase; Pro  89.5    0.17 3.6E-06   48.6   1.4   19  334-352     3-21  (215)
209 CHL00181 cbbX CbbX; Provisiona  89.5    0.17 3.7E-06   51.5   1.6   48  303-352    30-77  (287)
210 PRK14248 phosphate ABC transpo  89.5    0.19 4.1E-06   49.8   1.8   21  332-352    45-65  (268)
211 PRK13645 cbiO cobalt transport  89.5    0.18 3.9E-06   50.6   1.7   21  332-352    35-55  (289)
212 PRK13649 cbiO cobalt transport  89.5    0.18   4E-06   50.1   1.7   21  332-352    31-51  (280)
213 PF13191 AAA_16:  AAA ATPase do  89.5    0.14   3E-06   46.5   0.7   21  332-352    22-42  (185)
214 PRK11650 ugpC glycerol-3-phosp  89.5    0.18 3.9E-06   52.8   1.7   21  332-352    28-48  (356)
215 TIGR03415 ABC_choXWV_ATP choli  89.5    0.16 3.5E-06   54.0   1.3   21  332-352    48-68  (382)
216 PTZ00301 uridine kinase; Provi  89.4    0.15 3.4E-06   49.7   1.1   17  336-352     5-21  (210)
217 PRK15056 manganese/iron transp  89.4    0.19 4.2E-06   50.0   1.8   21  332-352    31-51  (272)
218 PF01926 MMR_HSR1:  50S ribosom  89.4    0.18 3.9E-06   43.1   1.4   16  337-352     2-17  (116)
219 PRK14240 phosphate transporter  89.4     0.2 4.3E-06   48.9   1.8   21  332-352    27-47  (250)
220 cd04164 trmE TrmE (MnmE, ThdF,  89.4    0.19 4.1E-06   43.6   1.5   19  334-352     1-19  (157)
221 COG1127 Ttg2A ABC-type transpo  89.3    0.23 5.1E-06   50.4   2.3   30  323-352    22-52  (263)
222 PRK14259 phosphate ABC transpo  89.3     0.2 4.3E-06   49.9   1.8   21  332-352    37-57  (269)
223 PRK13541 cytochrome c biogenes  89.3     0.2 4.4E-06   47.1   1.8   21  332-352    24-44  (195)
224 cd03369 ABCC_NFT1 Domain 2 of   89.3    0.21 4.5E-06   47.3   1.8   21  332-352    32-52  (207)
225 cd03244 ABCC_MRP_domain2 Domai  89.2    0.21 4.5E-06   47.6   1.8   21  332-352    28-48  (221)
226 TIGR01277 thiQ thiamine ABC tr  89.2     0.2 4.3E-06   47.8   1.6   21  332-352    22-42  (213)
227 PF10662 PduV-EutP:  Ethanolami  89.2    0.16 3.5E-06   47.3   1.0   18  335-352     2-19  (143)
228 cd03251 ABCC_MsbA MsbA is an e  89.2    0.21 4.6E-06   48.0   1.8   21  332-352    26-46  (234)
229 PRK14256 phosphate ABC transpo  89.2    0.21 4.5E-06   48.9   1.8   21  332-352    28-48  (252)
230 PRK11607 potG putrescine trans  89.2     0.2 4.3E-06   53.0   1.8   21  332-352    43-63  (377)
231 PRK11701 phnK phosphonate C-P   89.2     0.2 4.3E-06   49.2   1.7   21  332-352    30-50  (258)
232 cd03228 ABCC_MRP_Like The MRP   89.2    0.22 4.7E-06   46.0   1.8   21  332-352    26-46  (171)
233 PF00448 SRP54:  SRP54-type pro  89.2    0.16 3.4E-06   49.0   1.0   18  335-352     2-19  (196)
234 PRK06696 uridine kinase; Valid  89.2    0.17 3.7E-06   49.0   1.2   18  335-352    23-40  (223)
235 PRK11144 modC molybdate transp  89.2     0.2 4.4E-06   52.1   1.8   21  332-352    22-42  (352)
236 cd01876 YihA_EngB The YihA (En  89.1    0.17 3.7E-06   43.9   1.1   16  337-352     2-17  (170)
237 PRK13632 cbiO cobalt transport  89.1    0.21 4.5E-06   49.7   1.8   21  332-352    33-53  (271)
238 cd03290 ABCC_SUR1_N The SUR do  89.1    0.21 4.6E-06   47.6   1.8   21  332-352    25-45  (218)
239 cd03248 ABCC_TAP TAP, the Tran  89.1    0.21 4.6E-06   47.8   1.8   21  332-352    38-58  (226)
240 PRK10619 histidine/lysine/argi  89.1    0.21 4.5E-06   49.0   1.8   21  332-352    29-49  (257)
241 PRK13548 hmuV hemin importer A  89.1    0.21 4.5E-06   49.4   1.7   21  332-352    26-46  (258)
242 cd03234 ABCG_White The White s  89.1     0.2 4.4E-06   48.2   1.6   21  332-352    31-51  (226)
243 PRK13638 cbiO cobalt transport  89.1    0.21 4.5E-06   49.6   1.8   21  332-352    25-45  (271)
244 PRK13547 hmuV hemin importer A  89.1    0.21 4.5E-06   50.1   1.8   21  332-352    25-45  (272)
245 cd03233 ABC_PDR_domain1 The pl  89.1    0.21 4.6E-06   47.5   1.7   21  332-352    31-51  (202)
246 PRK11545 gntK gluconate kinase  89.1    0.11 2.3E-06   48.3  -0.3   13  340-352     1-13  (163)
247 PRK15112 antimicrobial peptide  89.0    0.21 4.6E-06   49.5   1.8   21  332-352    37-57  (267)
248 PRK10851 sulfate/thiosulfate t  89.0    0.21 4.5E-06   52.3   1.8   21  332-352    26-46  (353)
249 PRK14261 phosphate ABC transpo  89.0    0.22 4.7E-06   48.8   1.8   21  332-352    30-50  (253)
250 TIGR02769 nickel_nikE nickel i  89.0    0.22 4.7E-06   49.3   1.8   21  332-352    35-55  (265)
251 TIGR02639 ClpA ATP-dependent C  89.0    0.36 7.8E-06   55.1   3.8   82  336-420   486-595 (731)
252 PRK14270 phosphate ABC transpo  88.9    0.22 4.8E-06   48.6   1.8   21  332-352    28-48  (251)
253 COG4161 ArtP ABC-type arginine  88.9    0.23   5E-06   48.3   1.9   21  332-352    26-46  (242)
254 PRK09984 phosphonate/organopho  88.9    0.22 4.7E-06   49.1   1.8   21  332-352    28-48  (262)
255 PRK15093 antimicrobial peptide  88.9    0.22 4.7E-06   51.4   1.8   21  332-352    31-51  (330)
256 PRK11000 maltose/maltodextrin   88.9    0.21 4.5E-06   52.5   1.7   21  332-352    27-47  (369)
257 TIGR02868 CydC thiol reductant  88.9    0.21 4.5E-06   54.1   1.8   21  332-352   359-379 (529)
258 PRK11614 livF leucine/isoleuci  88.9    0.21 4.7E-06   48.2   1.7   21  332-352    29-49  (237)
259 PRK14237 phosphate transporter  88.9    0.22 4.8E-06   49.4   1.8   21  332-352    44-64  (267)
260 PRK14253 phosphate ABC transpo  88.9    0.23 4.9E-06   48.4   1.8   21  332-352    27-47  (249)
261 PRK09544 znuC high-affinity zi  88.8    0.22 4.9E-06   49.2   1.8   21  332-352    28-48  (251)
262 PRK14272 phosphate ABC transpo  88.8    0.23 4.9E-06   48.4   1.8   21  332-352    28-48  (252)
263 PRK14531 adenylate kinase; Pro  88.8    0.18 3.8E-06   47.3   1.0   17  336-352     4-20  (183)
264 TIGR01188 drrA daunorubicin re  88.8    0.22 4.9E-06   50.4   1.8   21  332-352    17-37  (302)
265 TIGR03499 FlhF flagellar biosy  88.8    0.19 4.2E-06   50.8   1.3   21  332-352   192-212 (282)
266 PRK10418 nikD nickel transport  88.8    0.23   5E-06   48.8   1.8   21  332-352    27-47  (254)
267 KOG4238 Bifunctional ATP sulfu  88.7    0.16 3.4E-06   54.2   0.7   35  333-367    49-83  (627)
268 TIGR01186 proV glycine betaine  88.7    0.21 4.6E-06   52.6   1.6   21  332-352    17-37  (363)
269 PRK14245 phosphate ABC transpo  88.7    0.23 4.9E-06   48.5   1.7   21  332-352    27-47  (250)
270 PRK09580 sufC cysteine desulfu  88.7    0.23   5E-06   48.1   1.8   21  332-352    25-45  (248)
271 cd03294 ABC_Pro_Gly_Bertaine T  88.7    0.23   5E-06   49.4   1.8   21  332-352    48-68  (269)
272 cd00267 ABC_ATPase ABC (ATP-bi  88.7    0.24 5.3E-06   44.8   1.8   21  332-352    23-43  (157)
273 PRK14251 phosphate ABC transpo  88.7    0.24 5.1E-06   48.3   1.8   21  332-352    28-48  (251)
274 KOG0055 Multidrug/pheromone ex  88.7   0.079 1.7E-06   63.4  -1.8   20  333-352  1015-1034(1228)
275 PRK10253 iron-enterobactin tra  88.6    0.24 5.2E-06   49.1   1.8   21  332-352    31-51  (265)
276 TIGR02142 modC_ABC molybdenum   88.6    0.23   5E-06   51.7   1.8   21  332-352    21-41  (354)
277 PRK10419 nikE nickel transport  88.6    0.24 5.2E-06   49.3   1.8   21  332-352    36-56  (268)
278 PRK00698 tmk thymidylate kinas  88.6     0.2 4.3E-06   46.7   1.2   19  334-352     3-21  (205)
279 PF00910 RNA_helicase:  RNA hel  88.6    0.16 3.4E-06   43.9   0.4   17  337-353     1-17  (107)
280 cd03300 ABC_PotA_N PotA is an   88.6    0.24 5.3E-06   47.8   1.8   21  332-352    24-44  (232)
281 PRK14244 phosphate ABC transpo  88.6    0.24 5.3E-06   48.4   1.8   21  332-352    29-49  (251)
282 TIGR00968 3a0106s01 sulfate AB  88.6    0.24 5.3E-06   48.1   1.8   21  332-352    24-44  (237)
283 TIGR01288 nodI ATP-binding ABC  88.6    0.24 5.1E-06   50.3   1.8   21  332-352    28-48  (303)
284 PRK14235 phosphate transporter  88.5    0.24 5.3E-06   49.1   1.8   21  332-352    43-63  (267)
285 cd03240 ABC_Rad50 The catalyti  88.5    0.25 5.4E-06   47.5   1.8   33  320-352     8-40  (204)
286 PRK14269 phosphate ABC transpo  88.5    0.25 5.3E-06   48.3   1.8   21  332-352    26-46  (246)
287 PRK13647 cbiO cobalt transport  88.5    0.24 5.2E-06   49.5   1.7   21  332-352    29-49  (274)
288 PRK14238 phosphate transporter  88.5    0.25 5.3E-06   49.3   1.8   21  332-352    48-68  (271)
289 PRK14268 phosphate ABC transpo  88.4    0.25 5.4E-06   48.6   1.8   21  332-352    36-56  (258)
290 cd03217 ABC_FeS_Assembly ABC-t  88.4    0.26 5.6E-06   46.8   1.8   21  332-352    24-44  (200)
291 PRK11231 fecE iron-dicitrate t  88.4    0.25 5.5E-06   48.4   1.8   21  332-352    26-46  (255)
292 cd03253 ABCC_ATM1_transporter   88.4    0.26 5.6E-06   47.5   1.8   21  332-352    25-45  (236)
293 PRK14249 phosphate ABC transpo  88.3    0.26 5.6E-06   48.2   1.8   21  332-352    28-48  (251)
294 TIGR00455 apsK adenylylsulfate  88.3    0.23 5.1E-06   46.2   1.5   21  332-352    16-36  (184)
295 PRK14737 gmk guanylate kinase;  88.3    0.23 4.9E-06   47.4   1.4   20  333-352     3-22  (186)
296 smart00072 GuKc Guanylate kina  88.3    0.24 5.1E-06   46.5   1.5   19  334-352     2-20  (184)
297 PRK13646 cbiO cobalt transport  88.3    0.25 5.4E-06   49.7   1.7   21  332-352    31-51  (286)
298 cd03213 ABCG_EPDR ABCG transpo  88.3    0.26 5.7E-06   46.6   1.8   21  332-352    33-53  (194)
299 COG4618 ArpD ABC-type protease  88.3    0.17 3.7E-06   55.9   0.6   67  332-409   360-434 (580)
300 PRK14243 phosphate transporter  88.3    0.26 5.6E-06   48.8   1.8   21  332-352    34-54  (264)
301 PF08477 Miro:  Miro-like prote  88.3    0.23   5E-06   42.0   1.2   16  337-352     2-17  (119)
302 PRK05057 aroK shikimate kinase  88.2    0.24 5.3E-06   46.3   1.5   18  335-352     5-22  (172)
303 PF01695 IstB_IS21:  IstB-like   88.2    0.24 5.3E-06   46.9   1.5   20  333-352    46-65  (178)
304 TIGR03420 DnaA_homol_Hda DnaA   88.2    0.25 5.4E-06   46.8   1.6   19  334-352    38-56  (226)
305 TIGR03873 F420-0_ABC_ATP propo  88.2    0.26 5.7E-06   48.3   1.8   21  332-352    25-45  (256)
306 PRK14722 flhF flagellar biosyn  88.1    0.23   5E-06   52.9   1.4   21  332-352   135-155 (374)
307 PRK11153 metN DL-methionine tr  88.1    0.26 5.6E-06   51.2   1.8   21  332-352    29-49  (343)
308 PRK13651 cobalt transporter AT  88.1    0.25 5.5E-06   50.5   1.7   21  332-352    31-51  (305)
309 PF07724 AAA_2:  AAA domain (Cd  88.1    0.23 4.9E-06   46.9   1.2   17  336-352     5-21  (171)
310 cd04159 Arl10_like Arl10-like   88.1    0.23   5E-06   42.8   1.2   16  337-352     2-17  (159)
311 cd01130 VirB11-like_ATPase Typ  88.1    0.26 5.7E-06   46.4   1.6   21  332-352    23-43  (186)
312 PRK13635 cbiO cobalt transport  88.0    0.27 5.9E-06   49.3   1.8   21  332-352    31-51  (279)
313 PRK14266 phosphate ABC transpo  88.0    0.28 6.1E-06   47.8   1.8   21  332-352    27-47  (250)
314 PRK14252 phosphate ABC transpo  88.0    0.28   6E-06   48.5   1.8   21  332-352    40-60  (265)
315 PRK11308 dppF dipeptide transp  88.0    0.26 5.6E-06   51.0   1.6   21  332-352    39-59  (327)
316 PRK13634 cbiO cobalt transport  87.9    0.27 5.8E-06   49.6   1.7   21  332-352    31-51  (290)
317 TIGR03258 PhnT 2-aminoethylpho  87.9    0.27 5.9E-06   51.7   1.8   21  332-352    29-49  (362)
318 cd03283 ABC_MutS-like MutS-lik  87.9    0.26 5.7E-06   47.3   1.6   19  334-352    25-43  (199)
319 PRK14260 phosphate ABC transpo  87.9    0.28   6E-06   48.4   1.8   21  332-352    31-51  (259)
320 PRK11022 dppD dipeptide transp  87.9    0.27 5.8E-06   50.8   1.7   21  332-352    31-51  (326)
321 PRK03695 vitamin B12-transport  87.9    0.28 6.1E-06   48.1   1.8   21  332-352    20-40  (248)
322 PRK14265 phosphate ABC transpo  87.9    0.28 6.1E-06   49.0   1.8   21  332-352    44-64  (274)
323 PRK14275 phosphate ABC transpo  87.9    0.28 6.1E-06   49.4   1.8   21  332-352    63-83  (286)
324 TIGR02982 heterocyst_DevA ABC   87.8    0.29 6.3E-06   46.9   1.8   21  332-352    29-49  (220)
325 PRK08533 flagellar accessory p  87.8    0.28   6E-06   48.2   1.7   21  332-352    22-42  (230)
326 TIGR03345 VI_ClpV1 type VI sec  87.8     0.2 4.4E-06   58.3   0.8   83  336-420   598-710 (852)
327 PRK14254 phosphate ABC transpo  87.7    0.29 6.3E-06   49.3   1.8   21  332-352    63-83  (285)
328 PRK14532 adenylate kinase; Pro  87.7    0.23 4.9E-06   46.3   1.0   17  336-352     2-18  (188)
329 cd03236 ABC_RNaseL_inhibitor_d  87.7     0.3 6.5E-06   48.7   1.8   21  332-352    24-44  (255)
330 TIGR01618 phage_P_loop phage n  87.6    0.39 8.4E-06   47.6   2.6   29  330-358     8-37  (220)
331 cd04155 Arl3 Arl3 subfamily.    87.6    0.27 5.8E-06   44.1   1.4   18  335-352    15-32  (173)
332 PRK13650 cbiO cobalt transport  87.6    0.29 6.3E-06   49.1   1.7   21  332-352    31-51  (279)
333 COG4778 PhnL ABC-type phosphon  87.6    0.31 6.7E-06   47.8   1.8   38  315-352    15-55  (235)
334 cd01428 ADK Adenylate kinase (  87.6    0.23 5.1E-06   45.8   0.9   16  337-352     2-17  (194)
335 PRK13640 cbiO cobalt transport  87.6     0.3 6.4E-06   49.1   1.7   21  332-352    31-51  (282)
336 COG4608 AppF ABC-type oligopep  87.6     0.3 6.4E-06   50.0   1.7   21  332-352    37-57  (268)
337 PRK14236 phosphate transporter  87.5     0.3 6.5E-06   48.6   1.8   21  332-352    49-69  (272)
338 cd02028 UMPK_like Uridine mono  87.5    0.23   5E-06   46.8   0.9   16  337-352     2-17  (179)
339 PRK08356 hypothetical protein;  87.5    0.28 6.2E-06   46.4   1.5   20  333-352     4-23  (195)
340 PRK13639 cbiO cobalt transport  87.5     0.3 6.5E-06   48.8   1.7   21  332-352    26-46  (275)
341 PRK02496 adk adenylate kinase;  87.5    0.24 5.2E-06   46.1   1.0   17  336-352     3-19  (184)
342 TIGR02314 ABC_MetN D-methionin  87.5     0.3 6.4E-06   51.1   1.7   21  332-352    29-49  (343)
343 PRK14271 phosphate ABC transpo  87.5    0.31 6.7E-06   48.9   1.8   21  332-352    45-65  (276)
344 PRK09473 oppD oligopeptide tra  87.4    0.28 6.1E-06   50.7   1.6   21  332-352    40-60  (330)
345 cd03271 ABC_UvrA_II The excisi  87.4    0.29 6.3E-06   49.4   1.6   21  332-352    19-39  (261)
346 cd03279 ABC_sbcCD SbcCD and ot  87.4    0.31 6.6E-06   46.8   1.7   20  333-352    27-46  (213)
347 PRK13641 cbiO cobalt transport  87.4     0.3 6.6E-06   49.1   1.7   21  332-352    31-51  (287)
348 PRK13637 cbiO cobalt transport  87.3    0.31 6.6E-06   49.2   1.7   21  332-352    31-51  (287)
349 PRK13652 cbiO cobalt transport  87.3    0.31 6.8E-06   48.7   1.8   21  332-352    28-48  (277)
350 cd02020 CMPK Cytidine monophos  87.3    0.25 5.4E-06   43.2   1.0   16  337-352     2-17  (147)
351 PHA00729 NTP-binding motif con  87.3    0.25 5.4E-06   49.3   1.0   17  336-352    19-35  (226)
352 COG4555 NatA ABC-type Na+ tran  87.3    0.26 5.7E-06   49.2   1.2   21  332-352    26-46  (245)
353 COG1131 CcmA ABC-type multidru  87.3     0.3 6.6E-06   49.7   1.7   21  332-352    29-49  (293)
354 cd02025 PanK Pantothenate kina  87.2    0.24 5.1E-06   48.4   0.8   16  337-352     2-17  (220)
355 PRK13633 cobalt transporter AT  87.2    0.32   7E-06   48.7   1.8   21  332-352    34-54  (280)
356 PRK08084 DNA replication initi  87.2    0.28 6.1E-06   48.1   1.3   18  335-352    46-63  (235)
357 PRK06893 DNA replication initi  87.2    0.24 5.1E-06   48.4   0.8   18  335-352    40-57  (229)
358 CHL00095 clpC Clp protease ATP  87.2    0.59 1.3E-05   54.2   4.1   17  336-352   541-557 (821)
359 PRK15079 oligopeptide ABC tran  87.1    0.32   7E-06   50.4   1.8   21  332-352    45-65  (331)
360 cd03272 ABC_SMC3_euk Eukaryoti  87.1    0.36 7.7E-06   46.7   2.0   20  333-352    22-41  (243)
361 PRK13644 cbiO cobalt transport  87.0    0.33 7.2E-06   48.5   1.7   21  332-352    26-46  (274)
362 PRK11176 lipid transporter ATP  86.9    0.33 7.2E-06   53.1   1.8   21  332-352   367-387 (582)
363 TIGR02237 recomb_radB DNA repa  86.9    0.29 6.3E-06   46.2   1.2   21  332-352    10-30  (209)
364 cd01672 TMPK Thymidine monopho  86.9    0.27 5.9E-06   45.0   1.0   17  336-352     2-18  (200)
365 cd03299 ABC_ModC_like Archeal   86.9    0.35 7.6E-06   46.9   1.8   21  332-352    23-43  (235)
366 PRK06526 transposase; Provisio  86.8    0.29 6.4E-06   49.1   1.2   20  333-352    97-116 (254)
367 TIGR00635 ruvB Holliday juncti  86.8    0.29 6.2E-06   49.0   1.2   18  335-352    31-48  (305)
368 PRK13642 cbiO cobalt transport  86.8    0.35 7.5E-06   48.4   1.7   21  332-352    31-51  (277)
369 PRK13636 cbiO cobalt transport  86.8    0.35 7.6E-06   48.6   1.8   21  332-352    30-50  (283)
370 PRK13631 cbiO cobalt transport  86.8    0.35 7.5E-06   49.9   1.8   21  332-352    50-70  (320)
371 TIGR00231 small_GTP small GTP-  86.7    0.33 7.2E-06   41.1   1.3   17  336-352     3-19  (161)
372 PRK12726 flagellar biosynthesi  86.7    0.46   1E-05   51.2   2.7   43  303-352   182-224 (407)
373 PF13476 AAA_23:  AAA domain; P  86.7    0.31 6.7E-06   44.4   1.2   23  330-352    15-37  (202)
374 cd01394 radB RadB. The archaea  86.7    0.31 6.6E-06   46.5   1.2   20  333-352    18-37  (218)
375 PF05729 NACHT:  NACHT domain    86.7    0.31 6.7E-06   43.0   1.2   18  335-352     1-18  (166)
376 PHA02530 pseT polynucleotide k  86.7    0.28   6E-06   49.0   1.0   17  336-352     4-20  (300)
377 cd03297 ABC_ModC_molybdenum_tr  86.6    0.32 6.9E-06   46.3   1.3   18  335-352    24-41  (214)
378 PRK01184 hypothetical protein;  86.5    0.31 6.7E-06   45.2   1.2   17  336-352     3-19  (184)
379 PRK13546 teichoic acids export  86.5    0.37 8.1E-06   48.2   1.8   21  332-352    48-68  (264)
380 cd03288 ABCC_SUR2 The SUR doma  86.5    0.38 8.2E-06   47.4   1.8   21  332-352    45-65  (257)
381 PRK14258 phosphate ABC transpo  86.5    0.38 8.1E-06   47.6   1.8   21  332-352    31-51  (261)
382 PRK06620 hypothetical protein;  86.5     0.3 6.4E-06   47.6   1.0   18  335-352    45-62  (214)
383 PRK12339 2-phosphoglycerate ki  86.5    0.32   7E-06   47.0   1.3   19  334-352     3-21  (197)
384 PRK13643 cbiO cobalt transport  86.5    0.36 7.8E-06   48.7   1.7   21  332-352    30-50  (288)
385 COG1120 FepC ABC-type cobalami  86.4    0.38 8.2E-06   48.9   1.8   21  332-352    26-46  (258)
386 cd04160 Arfrp1 Arfrp1 subfamil  86.4    0.33 7.1E-06   43.2   1.2   16  337-352     2-17  (167)
387 PRK13947 shikimate kinase; Pro  86.4     0.3 6.5E-06   44.5   1.0   28  336-363     3-34  (171)
388 PRK14246 phosphate ABC transpo  86.4    0.39 8.4E-06   47.6   1.8   21  332-352    34-54  (257)
389 PRK13975 thymidylate kinase; P  86.4    0.33 7.2E-06   45.2   1.2   18  335-352     3-20  (196)
390 PRK10938 putative molybdenum t  86.2    0.38 8.2E-06   51.8   1.8   21  332-352    27-47  (490)
391 cd02024 NRK1 Nicotinamide ribo  86.2     0.3 6.6E-06   47.0   0.9   16  337-352     2-17  (187)
392 cd03278 ABC_SMC_barmotin Barmo  86.0    0.38 8.1E-06   46.1   1.5   18  334-352    23-40  (197)
393 PRK08903 DnaA regulatory inact  86.0    0.37   8E-06   46.3   1.4   19  334-352    42-60  (227)
394 TIGR03269 met_CoM_red_A2 methy  86.0    0.39 8.5E-06   52.1   1.8   21  332-352    24-44  (520)
395 TIGR01351 adk adenylate kinase  86.0    0.32 6.9E-06   46.5   0.9   16  337-352     2-17  (210)
396 PF09439 SRPRB:  Signal recogni  85.9    0.38 8.3E-06   46.4   1.5   19  334-352     3-21  (181)
397 PRK13537 nodulation ABC transp  85.9     0.4 8.7E-06   48.9   1.7   21  332-352    31-51  (306)
398 cd04163 Era Era subfamily.  Er  85.8    0.39 8.4E-06   41.5   1.4   18  335-352     4-21  (168)
399 PF00625 Guanylate_kin:  Guanyl  85.8    0.39 8.5E-06   44.8   1.5   19  334-352     2-20  (183)
400 COG1132 MdlB ABC-type multidru  85.8    0.47   1E-05   52.0   2.3   21  332-352   353-373 (567)
401 PRK10762 D-ribose transporter   85.8    0.39 8.5E-06   51.9   1.6   21  332-352    28-48  (501)
402 PRK13657 cyclic beta-1,2-gluca  85.8    0.41 8.9E-06   52.7   1.8   21  332-352   359-379 (588)
403 cd01131 PilT Pilus retraction   85.8    0.35 7.6E-06   46.2   1.1   17  336-352     3-19  (198)
404 PRK14263 phosphate ABC transpo  85.7    0.43 9.3E-06   47.4   1.8   21  332-352    32-52  (261)
405 cd00876 Ras Ras family.  The R  85.7    0.36 7.8E-06   42.1   1.1   16  337-352     2-17  (160)
406 PRK04040 adenylate kinase; Pro  85.7    0.38 8.2E-06   46.0   1.3   18  335-352     3-20  (188)
407 PRK14264 phosphate ABC transpo  85.7    0.43 9.4E-06   48.5   1.8   21  332-352    69-89  (305)
408 cd04156 ARLTS1 ARLTS1 subfamil  85.6    0.37   8E-06   42.6   1.1   16  337-352     2-17  (160)
409 PRK09700 D-allose transporter   85.6    0.42   9E-06   51.8   1.7   21  332-352    29-49  (510)
410 TIGR03522 GldA_ABC_ATP gliding  85.6    0.41 8.8E-06   48.6   1.5   21  332-352    26-46  (301)
411 TIGR02857 CydD thiol reductant  85.5    0.44 9.5E-06   51.6   1.8   21  332-352   346-366 (529)
412 PRK09700 D-allose transporter   85.4    0.43 9.4E-06   51.6   1.7   21  332-352   287-307 (510)
413 COG1123 ATPase components of v  85.3    0.42 9.1E-06   53.2   1.6   21  332-352   315-335 (539)
414 PF13173 AAA_14:  AAA domain     85.2    0.45 9.9E-06   41.9   1.5   20  333-352     1-20  (128)
415 PF00025 Arf:  ADP-ribosylation  85.2    0.46   1E-05   44.1   1.6   18  335-352    15-32  (175)
416 PRK10522 multidrug transporter  85.2    0.45 9.8E-06   52.0   1.8   21  332-352   347-367 (547)
417 PRK09270 nucleoside triphospha  85.2    0.39 8.5E-06   46.6   1.2   19  334-352    33-51  (229)
418 PRK09361 radB DNA repair and r  85.2    0.42   9E-06   45.9   1.3   21  332-352    21-41  (225)
419 TIGR03574 selen_PSTK L-seryl-t  85.1    0.36 7.9E-06   47.3   0.9   16  337-352     2-17  (249)
420 cd03289 ABCC_CFTR2 The CFTR su  85.1    0.48   1E-05   47.9   1.8   21  332-352    28-48  (275)
421 COG2607 Predicted ATPase (AAA+  85.1    0.31 6.7E-06   49.7   0.4  131  335-475    86-232 (287)
422 PRK09087 hypothetical protein;  85.1     0.4 8.6E-06   47.1   1.2   19  334-352    44-62  (226)
423 TIGR03269 met_CoM_red_A2 methy  85.1    0.47   1E-05   51.5   1.8   21  332-352   308-328 (520)
424 PF13086 AAA_11:  AAA domain; P  85.1    0.36 7.8E-06   44.8   0.8   17  336-352    19-35  (236)
425 PRK03731 aroL shikimate kinase  85.0    0.42   9E-06   43.7   1.2   30  335-364     3-36  (171)
426 COG2255 RuvB Holliday junction  85.0    0.37 8.1E-06   50.1   1.0  119  335-474    53-188 (332)
427 smart00175 RAB Rab subfamily o  85.0    0.41 8.9E-06   42.1   1.1   17  336-352     2-18  (164)
428 PRK10982 galactose/methyl gala  85.0    0.46   1E-05   51.2   1.7   21  332-352    22-42  (491)
429 TIGR03015 pepcterm_ATPase puta  85.0    0.46   1E-05   46.2   1.6   39  300-352    23-61  (269)
430 PLN02165 adenylate isopentenyl  85.0    0.55 1.2E-05   49.4   2.2   31  333-363    42-76  (334)
431 PRK10938 putative molybdenum t  85.0    0.47   1E-05   51.0   1.7   21  332-352   284-304 (490)
432 cd01123 Rad51_DMC1_radA Rad51_  84.9    0.43 9.3E-06   45.7   1.3   21  332-352    17-37  (235)
433 PRK15134 microcin C ABC transp  84.9    0.46 9.9E-06   51.8   1.7   21  332-352    33-53  (529)
434 COG1100 GTPase SAR1 and relate  84.9     0.4 8.8E-06   44.9   1.1   18  335-352     6-23  (219)
435 cd03291 ABCC_CFTR1 The CFTR su  84.9     0.5 1.1E-05   47.9   1.8   21  332-352    61-81  (282)
436 TIGR00041 DTMP_kinase thymidyl  84.9    0.42 9.2E-06   44.4   1.2   19  334-352     3-21  (195)
437 cd04123 Rab21 Rab21 subfamily.  84.9    0.46 9.9E-06   41.5   1.3   17  336-352     2-18  (162)
438 cd04138 H_N_K_Ras_like H-Ras/N  84.9    0.42   9E-06   41.8   1.1   17  336-352     3-19  (162)
439 cd01393 recA_like RecA is a  b  84.8     0.5 1.1E-05   45.0   1.7   21  332-352    17-37  (226)
440 TIGR02203 MsbA_lipidA lipid A   84.8    0.49 1.1E-05   51.5   1.8   21  332-352   356-376 (571)
441 TIGR02633 xylG D-xylose ABC tr  84.8    0.47   1E-05   51.2   1.7   21  332-352    25-45  (500)
442 PRK07667 uridine kinase; Provi  84.7    0.43 9.4E-06   45.3   1.2   18  335-352    18-35  (193)
443 PRK15134 microcin C ABC transp  84.7    0.49 1.1E-05   51.5   1.7   21  332-352   310-330 (529)
444 PRK12288 GTPase RsgA; Reviewed  84.7     1.6 3.5E-05   45.9   5.5   19  334-352   205-223 (347)
445 cd01128 rho_factor Transcripti  84.7    0.46   1E-05   47.7   1.4   20  333-352    15-34  (249)
446 TIGR03878 thermo_KaiC_2 KaiC d  84.7    0.43 9.3E-06   47.7   1.2   20  333-352    35-54  (259)
447 PRK13549 xylose transporter AT  84.6    0.46 9.9E-06   51.5   1.5   21  332-352    29-49  (506)
448 PRK13946 shikimate kinase; Pro  84.6    0.46   1E-05   44.6   1.3   19  334-352    10-28  (184)
449 cd01124 KaiC KaiC is a circadi  84.6    0.39 8.5E-06   44.0   0.8   16  337-352     2-17  (187)
450 COG0444 DppD ABC-type dipeptid  84.5    0.84 1.8E-05   47.7   3.3   21  332-352    29-49  (316)
451 PRK10790 putative multidrug tr  84.5    0.51 1.1E-05   51.9   1.8   21  332-352   365-385 (592)
452 cd03273 ABC_SMC2_euk Eukaryoti  84.5     0.6 1.3E-05   45.9   2.1   20  333-352    24-43  (251)
453 PRK06995 flhF flagellar biosyn  84.5    0.44 9.6E-06   52.4   1.3   20  333-352   255-274 (484)
454 PRK14528 adenylate kinase; Pro  84.4    0.46   1E-05   44.9   1.2   17  336-352     3-19  (186)
455 PRK13549 xylose transporter AT  84.4     0.5 1.1E-05   51.2   1.7   21  332-352   286-306 (506)
456 cd04139 RalA_RalB RalA/RalB su  84.4    0.49 1.1E-05   41.5   1.3   17  336-352     2-18  (164)
457 PRK15064 ABC transporter ATP-b  84.4    0.53 1.2E-05   51.3   1.9   21  332-352    25-45  (530)
458 PRK10751 molybdopterin-guanine  84.4    0.45 9.9E-06   45.5   1.2   18  335-352     7-24  (173)
459 PF06745 KaiC:  KaiC;  InterPro  84.3    0.54 1.2E-05   45.1   1.7   21  332-352    17-37  (226)
460 PRK04182 cytidylate kinase; Pr  84.3    0.46   1E-05   43.1   1.2   17  336-352     2-18  (180)
461 KOG0057 Mitochondrial Fe/S clu  84.3    0.31 6.7E-06   54.3   0.0   21  332-352   376-396 (591)
462 PRK13536 nodulation factor exp  84.3    0.54 1.2E-05   49.0   1.8   21  332-352    65-85  (340)
463 PF13481 AAA_25:  AAA domain; P  84.3    0.55 1.2E-05   43.4   1.7   21  332-352    30-50  (193)
464 PRK05703 flhF flagellar biosyn  84.2    0.47   1E-05   51.1   1.3   42  304-352   198-239 (424)
465 TIGR03881 KaiC_arch_4 KaiC dom  84.2    0.52 1.1E-05   45.2   1.5   21  332-352    18-38  (229)
466 cd04119 RJL RJL (RabJ-Like) su  84.1    0.52 1.1E-05   41.4   1.3   17  336-352     2-18  (168)
467 cd00154 Rab Rab family.  Rab G  84.0    0.48   1E-05   40.6   1.1   17  336-352     2-18  (159)
468 PF03205 MobB:  Molybdopterin g  84.0    0.53 1.1E-05   43.1   1.4   17  336-352     2-18  (140)
469 cd03243 ABC_MutS_homologs The   84.0    0.56 1.2E-05   44.5   1.6   20  333-352    28-47  (202)
470 PRK10762 D-ribose transporter   83.9    0.54 1.2E-05   50.9   1.7   21  332-352   276-296 (501)
471 PRK15064 ABC transporter ATP-b  83.9    0.56 1.2E-05   51.1   1.8   21  332-352   343-363 (530)
472 COG1122 CbiO ABC-type cobalt t  83.9    0.59 1.3E-05   46.6   1.8   21  332-352    28-48  (235)
473 PRK15439 autoinducer 2 ABC tra  83.9    0.56 1.2E-05   51.0   1.7   21  332-352    35-55  (510)
474 PRK00080 ruvB Holliday junctio  83.9    0.44 9.6E-06   48.8   0.9   18  335-352    52-69  (328)
475 PRK11160 cysteine/glutathione   83.8    0.57 1.2E-05   51.7   1.8   21  332-352   364-384 (574)
476 PRK10416 signal recognition pa  83.8     0.5 1.1E-05   49.1   1.2   20  333-352   113-132 (318)
477 TIGR02173 cyt_kin_arch cytidyl  83.8    0.51 1.1E-05   42.6   1.2   17  336-352     2-18  (171)
478 PRK14257 phosphate ABC transpo  83.7     0.6 1.3E-05   48.4   1.8   21  332-352   106-126 (329)
479 COG3265 GntK Gluconate kinase   83.6    0.36 7.8E-06   45.9   0.1   26  340-365     1-31  (161)
480 cd04137 RheB Rheb (Ras Homolog  83.6    0.56 1.2E-05   42.5   1.4   18  335-352     2-19  (180)
481 COG2884 FtsE Predicted ATPase   83.6    0.59 1.3E-05   46.3   1.6   21  332-352    26-46  (223)
482 TIGR01842 type_I_sec_PrtD type  83.6    0.59 1.3E-05   51.0   1.8   21  332-352   342-362 (544)
483 PRK15453 phosphoribulokinase;   83.5     0.6 1.3E-05   48.3   1.7   19  334-352     5-23  (290)
484 smart00173 RAS Ras subfamily o  83.5    0.52 1.1E-05   41.8   1.1   17  336-352     2-18  (164)
485 PLN02772 guanylate kinase       83.5     1.5 3.2E-05   47.3   4.6   46  297-352   108-153 (398)
486 TIGR01193 bacteriocin_ABC ABC-  83.5     0.6 1.3E-05   52.7   1.8   21  332-352   498-518 (708)
487 TIGR02633 xylG D-xylose ABC tr  83.4    0.57 1.2E-05   50.6   1.6   21  332-352   284-304 (500)
488 PRK08181 transposase; Validate  83.4    0.56 1.2E-05   47.7   1.4   20  333-352   105-124 (269)
489 cd04114 Rab30 Rab30 subfamily.  83.4    0.57 1.2E-05   41.7   1.4   18  335-352     8-25  (169)
490 TIGR01194 cyc_pep_trnsptr cycl  83.4    0.59 1.3E-05   51.3   1.7   21  332-352   366-386 (555)
491 PRK05537 bifunctional sulfate   83.3    0.56 1.2E-05   52.4   1.5   22  331-352   389-410 (568)
492 PF13521 AAA_28:  AAA domain; P  83.3    0.41   9E-06   43.6   0.4   16  337-352     2-17  (163)
493 cd00879 Sar1 Sar1 subfamily.    83.2    0.58 1.3E-05   42.9   1.4   19  334-352    19-37  (190)
494 PRK10982 galactose/methyl gala  83.2     0.6 1.3E-05   50.3   1.6   21  332-352   272-292 (491)
495 PRK10789 putative multidrug tr  83.2    0.62 1.4E-05   51.3   1.8   21  332-352   339-359 (569)
496 PRK11288 araG L-arabinose tran  83.1     0.6 1.3E-05   50.5   1.6   21  332-352   277-297 (501)
497 cd04124 RabL2 RabL2 subfamily.  83.1    0.55 1.2E-05   42.2   1.1   17  336-352     2-18  (161)
498 PRK11147 ABC transporter ATPas  83.1    0.63 1.4E-05   52.1   1.8   21  332-352    27-47  (635)
499 PRK11819 putative ABC transpor  83.1    0.65 1.4E-05   51.1   1.9   21  332-352    31-51  (556)
500 cd01898 Obg Obg subfamily.  Th  83.1    0.54 1.2E-05   41.8   1.0   17  336-352     2-18  (170)

No 1  
>PLN02597 phosphoenolpyruvate carboxykinase [ATP]
Probab=100.00  E-value=2.3e-130  Score=1035.10  Aligned_cols=380  Identities=90%  Similarity=1.424  Sum_probs=365.5

Q ss_pred             CccccCCCCCcCCCCCCCCCCCCCCCCCcccchhccCcccceeEEcCCHHHHHHHHHhhcCCeEEecCCceEEecCCeec
Q 011221          102 PKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTG  181 (490)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~l~~~gl~~~~v~~Nls~~eL~e~A~~~~~g~~~t~~GaL~~~tG~~TG  181 (490)
                      |+|++|||..+..+++.        ..++...|..+|++..+|+|||++++|||+|+++++|++++++|+|+++||++||
T Consensus         1 ~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~v~~nl~~~~Lye~Al~~~eG~l~~~~GaL~v~TGk~TG   72 (555)
T PLN02597          1 PKVVRGDPARKKEPPKS--------VVAPTIDVSDSGLKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTG   72 (555)
T ss_pred             CccccCCccccCcCccc--------ccccccccccccCCcceEEeCCCHHHHHHHHHHhCCCeEEecCCCEEecCCCcCC
Confidence            78999999887765543        4777889999999999999999999999999999999877779999999999999


Q ss_pred             CCCCCeeeecCCCccccccccC------cCccc---------------ccEEEEEeeecCCCCCeEEEEEEecccchHHH
Q 011221          182 RSPRDKRVVKDETTEHELWWGK------MKNHD---------------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLF  240 (490)
Q Consensus       182 RSpkdk~iV~~~~t~~~i~wg~------~~e~~---------------~~lyv~D~~vG~d~~~~i~vRvit~~a~~alf  240 (490)
                      |||+|||||+++.++++||||+      |++++               ++|||+|+|+|+||++|++||+|+++|||+||
T Consensus        73 RSP~DKfIV~d~~t~~~iwWg~g~vN~p~~~~~f~~l~~~~~~~l~~~~~lfv~D~~~Gad~~~r~~vRvite~aw~alF  152 (555)
T PLN02597         73 RSPKDKRVVRDETTEDELWWGKGSPNIEMDEETFLVNRERAVDYLNSLDKVFVNDQFLNWDPENRIKVRIVSARAYHSLF  152 (555)
T ss_pred             CCcccceecCCCCcccceeccCCccCccCCHHHHHHHHHHHHHHHccCCCEEEEeeeeccCccceeeEEEEeCHHHHHHH
Confidence            9999999999999999999964      44432               46999999999999999999999999999999


Q ss_pred             HhhcccCCChHhhccCCCCCEEEEEcCCCCCCccCCCCCcccEEEEecCCCeEEEEcccchhhhHHHHHHHHHHhcccCC
Q 011221          241 MHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQ  320 (490)
Q Consensus       241 ~~NLf~rp~~~e~~~~~~pD~tI~~ap~f~~~~~~~g~~s~~~i~id~~~~~~~I~Gt~Y~GEmKK~iltl~~~~l~~~G  320 (490)
                      ++|||+||+.+|++.|++||||||++|+|+++|+.+|++|+++|++|+++++++|+||+|+|||||++||+|||+|++||
T Consensus       153 ~~nmfirP~~~el~~f~~PdftIi~ap~f~a~~~~~g~~Se~~i~in~~~~~~lI~GT~YaGE~KK~iFs~~~~ll~~rg  232 (555)
T PLN02597        153 MHNMCIRPTPEELEDFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLKRKEMVILGTQYAGEMKKGLFSLMHYLMPMRG  232 (555)
T ss_pred             HHhcCCCCChHHhccCCCCCEEEEeCCCCCCCccccCCCCCcEEEEEccCCeEEEEccchhhhhHHHHHHHHHHHHHHCC
Confidence            99999999999999998999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeeccccccCCCCCEEEEEeCCCCCcccccccCCCceeecCceeecCCCccccCcceEEeecCCCCCCCcchhhccccc
Q 011221          321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFG  400 (490)
Q Consensus       321 ~L~~H~sani~~~g~~~lffGlSGtGKTTLs~~~~~~lI~DD~~~wsd~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~  400 (490)
                      +|+||||||++.+|++++||||||||||||++++++.||+||+|+|+++||||||||||||||+|++|+||+||+|++|+
T Consensus       233 ~l~mHasaNv~~~g~~~lffGlSGtGKTTLsad~~~~li~DDEHgW~~~GVfNfEGGCYAK~i~Ls~e~EPeI~~Ai~fg  312 (555)
T PLN02597        233 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDPNRYLIGDDEHCWSDNGVSNIEGGCYAKCIDLSEEKEPDIWNAIKFG  312 (555)
T ss_pred             cEeecCeeccCCCCcEEEEEecCCCCccceecCCCCceeecccccccCCceEeecCceEEEecCCCcccchHHHHhcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeeeEEcCCCCeeecCCCCccccceEEEecccccCCCCCCCCCCccEEEEEEeecCCCCCCccccCHHHHHHHHHhcc
Q 011221          401 AVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGY  480 (490)
Q Consensus       401 ailENV~lD~~~~~vdf~d~s~T~NtRa~yPi~~i~N~~~~~~~g~P~~IIfLt~DafgvLPPVskLt~eQA~y~FlsGy  480 (490)
                      +|||||++|++++.|||+|.|+|+|||++|||++|+|+..|++++||++||||+||||||||||||||+|||||||||||
T Consensus       313 avLENVv~d~~~~~~df~D~s~TeNtR~aYPi~~I~na~~p~~~~hP~~IifLT~DAfGVlPPvskLt~eQA~yhFlsGy  392 (555)
T PLN02597        313 TVLENVVFDEHTREVDYSDKSVTENTRASYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLTLAQTMYHFISGY  392 (555)
T ss_pred             ceEEeeEECCCCCccCCcCCcccccceEEeEHHhccccCCCccCCCCCEEEEEeccccCCCCccccCCHHHHHHHHHhcc
Confidence            99999999999888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccc
Q 011221          481 TALVCAMSL  489 (490)
Q Consensus       481 takvagte~  489 (490)
                      ||||||||.
T Consensus       393 TakvAGTE~  401 (555)
T PLN02597        393 TALVAGTED  401 (555)
T ss_pred             eeccccccC
Confidence            999999995


No 2  
>PTZ00311 phosphoenolpyruvate carboxykinase; Provisional
Probab=100.00  E-value=1.3e-125  Score=1003.98  Aligned_cols=357  Identities=64%  Similarity=1.069  Sum_probs=344.1

Q ss_pred             ccchhccCcccceeEEcCCHHHHHHHHH-hhcCCeEEecCCceEEecCCeecCCCCCeeeecCCCccccccccC----cC
Q 011221          131 TISVSDSSLKFTHVLYNLSPAELYEQAI-KYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MK  205 (490)
Q Consensus       131 ~~~l~~~gl~~~~v~~Nls~~eL~e~A~-~~~~g~~~t~~GaL~~~tG~~TGRSpkdk~iV~~~~t~~~i~wg~----~~  205 (490)
                      ...|...||.+.+++|||++++|||+|+ ++++| .+|++|+|+++||++|||||+|||||+++.++++||||+    |+
T Consensus        31 ~~~l~~~g~~~~~i~~Nl~~~~L~E~al~~~~~g-~~t~~GaL~v~TG~~TGRSpkDKfIV~~~~~~d~i~Wg~vN~p~~  109 (561)
T PTZ00311         31 EEELHKLGLHNTTIHRNLTVPELYEHALKYEKNT-SITSTGALCVYSGAKTGRSPKDKRIVKEDSSEDDIWWGKVNIPLS  109 (561)
T ss_pred             hccHhhcCCCCCeEEeCCCHHHHHHHHHhhcCCc-EEecCCceEEecCCccCCCCCceEEeCCCCcccccccCccCccCC
Confidence            3446678898889999999999999999 56677 599999999999999999999999999999999999998    44


Q ss_pred             cc---------------cccEEEEEeeecCCCCCeEEEEEEecccchHHHHhhcccCCChHhh----ccCCCCCEEEEEc
Q 011221          206 NH---------------DVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEEL----ENFGTPDFTIYNA  266 (490)
Q Consensus       206 e~---------------~~~lyv~D~~vG~d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~----~~~~~pD~tI~~a  266 (490)
                      ++               .++|||+|+|+|+||+|+++||+|+++|||+|||+|||++|+.+|+    +.| +||||||++
T Consensus       110 ~~~f~~L~~~~~~yl~~~~~lyv~D~~vGaDp~~~l~vRvit~~a~~alF~~nmfirP~~~el~~~~~~f-~PdftIi~~  188 (561)
T PTZ00311        110 EESFEINKKRAIDYLNTRERLFVVDGYAGWDPKYRLKVRVITTRAYHALFMRNMLIRPTNEELKKFGEDF-VPDFTIYNA  188 (561)
T ss_pred             HHHHHHHHHHHHHHHhcCCCEEEEeeeeecCcccceeEEEEecHHHHHHHHHHCCCCCChHHhhccccCC-CCCEEEEEC
Confidence            43               2689999999999999999999999999999999999999999999    777 899999999


Q ss_pred             CCCCCCccCCCCCcccEEEEecCCCeEEEEcccchhhhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCC
Q 011221          267 GQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTG  346 (490)
Q Consensus       267 p~f~~~~~~~g~~s~~~i~id~~~~~~~I~Gt~Y~GEmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtG  346 (490)
                      |+|+++++.+|++|+++|++|+++++++|+||+|+|||||++||+||++|++||+||||||||++++|++++||||||||
T Consensus       189 P~f~a~~~~~G~~se~~i~in~~~~~~lI~GT~YaGEiKKgiFt~~~~ll~~rg~l~lHasa~v~~~g~~~~ffGlSGtG  268 (561)
T PTZ00311        189 GEFKANRLIEGVTSETSVALNFKRREMVILGTQYAGEMKKGILTVMMYLMPKQGVLPLHSSANVGKKGDVTLFFGLSGTG  268 (561)
T ss_pred             CCCCCCcccCCCCcccEEEEEccCCeEEEEcccchhhhHHHHHHHHHHHHHHCCceeeeeeEeeCCCCCEEEEEccCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCCceeecCceeecCCCccccCcceEEeecCCCCCCCcchhhcccccceeeeeEEcCCCCeeecCCCCccccc
Q 011221          347 KTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENT  426 (490)
Q Consensus       347 KTTLs~~~~~~lI~DD~~~wsd~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailENV~lD~~~~~vdf~d~s~T~Nt  426 (490)
                      ||||+++++|.||+||+|+|+++||||+|||||||||+|++|.||+||+|++|++|||||++|++++.|||+|.|+|+||
T Consensus       269 KtTLsa~~~~~li~DD~~gW~~~Gvfn~EGGCYAK~i~Ls~e~EPeI~~Ai~fgavLENVv~d~~~~~~df~d~s~TeNt  348 (561)
T PTZ00311        269 KTTLSADPNRKLIGDDEHVWTDDGVFNIEGGCYAKCIDLSKETEPEIYNAIRFGAVLENVVLDKVTREVDFNDISITENT  348 (561)
T ss_pred             HHHhccCCCCceeecccccccCCceEeecCceEEEecCCCcccChHHHHhhccCceEEeeEEcCCCCcccCCCCcccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999998899999999999999


Q ss_pred             eEEEecccccCCCCCCCCCCccEEEEEEeecCCCCCCccccCHHHHHHHHHhccccccccccc
Q 011221          427 RAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVCAMSL  489 (490)
Q Consensus       427 Ra~yPi~~i~N~~~~~~~g~P~~IIfLt~DafgvLPPVskLt~eQA~y~FlsGytakvagte~  489 (490)
                      |++|||++|+|+.+|++++||++|||||||||||||||||||+|||||||||||||||||||.
T Consensus       349 R~ayP~~~I~na~~~~~~~~P~~IifLT~DafGVlPPvskLt~eQA~yhFlsGyTakvaGTE~  411 (561)
T PTZ00311        349 RCAYPLEHIPNAKIPAVGGHPKNIIFLTCDAFGVLPPVSKLTPEQAMYHFISGYTAKVAGTEV  411 (561)
T ss_pred             eEEeEHHhccccCCCCcCCCCCEEEEEeccccCCCCccccCCHHHHHHHHHcccccccccccc
Confidence            999999999999999999999999999999999999999999999999999999999999995


No 3  
>cd00484 PEPCK_ATP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity, this model describes the ATP-dependent groups.
Probab=100.00  E-value=1.2e-125  Score=998.59  Aligned_cols=345  Identities=66%  Similarity=1.059  Sum_probs=336.5

Q ss_pred             eeEEcCCHHHHHHHHHhhcCCeEEecCCceEEecCCeecCCCCCeeeecCCCccccccccC----cCccc----------
Q 011221          143 HVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MKNHD----------  208 (490)
Q Consensus       143 ~v~~Nls~~eL~e~A~~~~~g~~~t~~GaL~~~tG~~TGRSpkdk~iV~~~~t~~~i~wg~----~~e~~----------  208 (490)
                      +|+||++++||||+|+++.+| ++|++|+|+++||++|||||+|||||+++.++++||||+    |++++          
T Consensus         2 ~v~~Nls~~eL~E~A~~~~eg-~~t~~GaL~v~TG~~TGRSPkDkfIV~~~~t~~~i~wg~vn~~~~~~~f~~L~~~~~~   80 (508)
T cd00484           2 HIHHNLSPAELYEEALKRGEG-VLTSTGALAVDTGKKTGRSPKDKFIVDEPSSEDDIWWGKVNQPISEETFEILRERAVD   80 (508)
T ss_pred             ccccCCCHHHHHHHHHhCCCC-EEecCCCeEeccCCccCCCCCceeEeCCCCccccccccccCcCCCHHHHHHHHHHHHH
Confidence            589999999999999999777 599999999999999999999999999999999999998    44432          


Q ss_pred             ----ccEEEEEeeecCCCCCeEEEEEEecccchHHHHhhcccCCChHhhccCCCCCEEEEEcCCCCCCccCCCCCcccEE
Q 011221          209 ----VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSI  284 (490)
Q Consensus       209 ----~~lyv~D~~vG~d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~~~~~~pD~tI~~ap~f~~~~~~~g~~s~~~i  284 (490)
                          ++|||+|+|+|+||+||++||+|+++|||+|||+|||++|+.+|++.| +||||||++|+|+++++.+|++|+++|
T Consensus        81 yl~~~~lyv~D~~vGadp~~r~~vRvi~~~a~~alF~~nmfi~P~~eel~~f-~pdftI~~~P~f~~~~~~~G~~s~~~i  159 (508)
T cd00484          81 YLNTKKLFVFDGFAGADPEYRLKVRVITERAWHALFMRNMFIRPTEEELENF-GPDFTIYNAPKFKANPETDGMNSETFV  159 (508)
T ss_pred             HhcCCCEEEEeeeeecCcccceeeEEEECHHHHHHHHHhCCCCCChHHhccC-CcCEEEEECCCCcCCccccCCCcccEE
Confidence                789999999999999999999999999999999999999999999999 799999999999999999999999999


Q ss_pred             EEecCCCeEEEEcccchhhhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCcccccccCCCceeecCce
Q 011221          285 DLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEH  364 (490)
Q Consensus       285 ~id~~~~~~~I~Gt~Y~GEmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~~~~~~lI~DD~~  364 (490)
                      ++|+++++++|+||+|+|||||++|++||++|++||+|+||||||++.+|++++||||||||||||++++.|.||+||||
T Consensus       160 iin~~~~~~lI~GT~YaGEiKKgif~~~~~ll~~~g~l~lH~sanv~~~~~~~~ffGlSGtGKtTLsa~~~r~li~DDeh  239 (508)
T cd00484         160 IINFAEREMVIGGTEYAGEMKKGIFSVMNYLLPKKGVLSMHCSANVGKKGDVALFFGLSGTGKTTLSADPNRKLIGDDEH  239 (508)
T ss_pred             EEEccCCeEEEECccchhhhHHHHHHHHHHHHHhCCcEeeccccccCCCCCEEEEEecCCCCHHHhccCccCCeeccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eecCCCccccCcceEEeecCCCCCCCcchhhcccccceeeeeEEcCCCCeeecCCCCccccceEEEecccccCCCCCCCC
Q 011221          365 CWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVG  444 (490)
Q Consensus       365 ~wsd~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailENV~lD~~~~~vdf~d~s~T~NtRa~yPi~~i~N~~~~~~~  444 (490)
                      +|+++||||||||||||||+|++|.||+||+|++|++|||||++|+++++|||+|.|+|+|||++|||++|+|+..++++
T Consensus       240 gW~~~Gvfn~EGGcYaK~i~Ls~e~EP~I~~Ai~fgavlENVv~d~~~~~~df~d~s~TeNtR~~yP~~~I~na~~~~~~  319 (508)
T cd00484         240 GWSDRGVFNIEGGCYAKCINLSEEKEPEIYNAIKFGAVLENVVVDEETREVDYDDDSITENTRAAYPIEHIPNAVIPGVG  319 (508)
T ss_pred             ccCCCceEeecCceEEEecCCCcccChHHHHhhccCceEeeeEEcCCCCccCCCCCcccccceEEeEHHHccccCCCCcC
Confidence            99999999999999999999999999999999999999999999988899999999999999999999999999999999


Q ss_pred             CCccEEEEEEeecCCCCCCccccCHHHHHHHHHhccccccccccc
Q 011221          445 PHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVCAMSL  489 (490)
Q Consensus       445 g~P~~IIfLt~DafgvLPPVskLt~eQA~y~FlsGytakvagte~  489 (490)
                      +||++||||+||||||||||||||+|||||||||||||||||||.
T Consensus       320 ~~p~~iifLT~DafgVlPPvskLt~eQA~y~FlsGyTak~agTE~  364 (508)
T cd00484         320 GHPKNIIFLTADAFGVLPPVSKLTPEQAMYHFLSGYTAKVAGTER  364 (508)
T ss_pred             CCCCEEEEEeccccCCCCccccCCHHHHHHHHHcccccccccccc
Confidence            999999999999999999999999999999999999999999995


No 4  
>TIGR00224 pckA phosphoenolpyruvate carboxykinase (ATP). Involved in the gluconeogenesis pathway. It converts oxaloacetic acid to phosphoenolpyruvate using ATP. Enzyme is a monomer. The reaction is also catalysed by phosphoenolpyruvate carboxykinase (GTP) (EC 4.1.1.32) using GTP instead of ATP, described in PROSITE:PDOC00421
Probab=100.00  E-value=3.4e-125  Score=994.82  Aligned_cols=355  Identities=52%  Similarity=0.841  Sum_probs=341.4

Q ss_pred             cchhccCccc-ceeEEcCCHHHHHHHHHhh-----cCCeEEecCCceEEecCCeecCCCCCeeeecCCCccccccccC--
Q 011221          132 ISVSDSSLKF-THVLYNLSPAELYEQAIKY-----EQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK--  203 (490)
Q Consensus       132 ~~l~~~gl~~-~~v~~Nls~~eL~e~A~~~-----~~g~~~t~~GaL~~~tG~~TGRSpkdk~iV~~~~t~~~i~wg~--  203 (490)
                      ..|...|+.+ .+|+|||++++|||+|+++     ++| +++++|+|+++||++|||||||||||+++.++++||||+  
T Consensus         8 ~~l~~~g~~~~~~v~~Nl~~~~L~e~a~~~~~~~~~eg-~~t~~Gal~v~TG~~TGRSpkDK~IV~~~~t~~~i~Wg~vN   86 (532)
T TIGR00224         8 QELEALGISDVHDIVYNPSYAQLYEEELKPSLTGYEKG-VLTSTGAVAVDTGIFTGRSPKDKYIVEDETTKDTIWWGPVN   86 (532)
T ss_pred             hhHHhcCCCCCceEEeCCCHHHHHHHHHhhccccCCCc-eeccCCceEEecCCeeCCCcCceEEeCCCCcccccccCcCC
Confidence            4466777876 6899999999999999999     678 599999999999999999999999999999999999998  


Q ss_pred             --cCcc--------------cccEEEEEeeecCCCCCeEEEEEEecccchHHHHhhcccCCChHhhccCCCCCEEEEEcC
Q 011221          204 --MKNH--------------DVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAG  267 (490)
Q Consensus       204 --~~e~--------------~~~lyv~D~~vG~d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~~~~~~pD~tI~~ap  267 (490)
                        |+++              .++|||+|+|+|+||+||++||+|+++|||+||++|||++|+++|++.| +||||||++|
T Consensus        87 ~p~~~~~f~~L~~~v~~~l~~~~lyv~D~~~GaDp~~rl~vRvite~AwhalF~~nmfirP~~eel~~f-ePdftI~~~p  165 (532)
T TIGR00224        87 KPLSEETWQHLKGLVTRQLSRKRLFVVDAFCGADPKYRLSVRVVTEVAWQAHFVKNMFIRPTEEELAGF-EPDFTVMNGA  165 (532)
T ss_pred             cCCCHHHHHHHHHHHHHHhcCCCEEEEeeeeccCcccceeEEEEEcHHHHHHHHHhhCCCCChHHhccC-CCCEEEEeCC
Confidence              4443              2679999999999999999999999999999999999999999999999 9999999999


Q ss_pred             CCC-CCccCCCCCcccEEEEecCCCeEEEEcccchhhhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCC
Q 011221          268 QFP-CNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTG  346 (490)
Q Consensus       268 ~f~-~~~~~~g~~s~~~i~id~~~~~~~I~Gt~Y~GEmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtG  346 (490)
                      +|+ +++..+|++|+++|++|+++++++|+||+|+|||||++|++||++|++||+|+||||||++++|++++||||||||
T Consensus       166 ~f~~ad~~~~g~~S~~~i~in~~~~~~lI~GT~YaGEiKKgiFs~~~~ll~~rg~l~lH~sanv~~~g~~~~ffGlSGtG  245 (532)
T TIGR00224       166 KFTNPNWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGILSMHCSANVGEKGDVALFFGLSGTG  245 (532)
T ss_pred             CCCCCCcccCCCCcCcEEEEecccCeEEEECcchhhhhHHHHHHHHHHHHHhCCeEeecCeeeeCCCCCEEEEEecCCCC
Confidence            999 9999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCCceeecCceeecCCCccccCcceEEeecCCCCCCCcchhhcccccceeeeeEEcCCCCeeecCCCCccccc
Q 011221          347 KTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENT  426 (490)
Q Consensus       347 KTTLs~~~~~~lI~DD~~~wsd~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailENV~lD~~~~~vdf~d~s~T~Nt  426 (490)
                      ||||++++.|.||+||+|+|+++||||||||||||||+|++|+||+||+|++|++|||||++|++ +.|||+|.|+|+||
T Consensus       246 KTTLsad~~r~li~DDEhgW~~~Gvfn~EGGCYaK~i~Ls~e~EPeI~~Ai~fgavLENVv~d~~-~~vdf~d~s~TeNt  324 (532)
T TIGR00224       246 KTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIHLSEEKEPEIYNAIRRDALLENVVVRED-GTVDFDDGSKTENT  324 (532)
T ss_pred             hhhhhccccccccccccccccCCceEeecCceEEEecCCCcccchHHHHhcCCCceEEeeeECCC-CCccCCCCcccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999997 89999999999999


Q ss_pred             eEEEecccccCCCCCC-CCCCccEEEEEEeecCCCCCCccccCHHHHHHHHHhccccccccccc
Q 011221          427 RAAYPIEYIPNAKIPC-VGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVCAMSL  489 (490)
Q Consensus       427 Ra~yPi~~i~N~~~~~-~~g~P~~IIfLt~DafgvLPPVskLt~eQA~y~FlsGytakvagte~  489 (490)
                      |++|||++|+|+..++ +++||++|||||||||||||||||||||||||||||||||||||||.
T Consensus       325 R~ayPi~~I~n~~~~~~~~~~p~~iifLT~DAfGVlPPvskLt~eQA~yhFlsGyTakvAGTE~  388 (532)
T TIGR00224       325 RVSYPIYHIDNIVKPVSAAGHATKVIFLTADAFGVLPPVSKLTPEQTMYHFLSGFTAKLAGTER  388 (532)
T ss_pred             eEEeEHHhccccCCCCccCCCCCEEEEEeccccCCCCccccCCHHHHHHHHHhcceeccccccC
Confidence            9999999999998787 77899999999999999999999999999999999999999999994


No 5  
>COG1866 PckA Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion]
Probab=100.00  E-value=8.4e-122  Score=948.83  Aligned_cols=354  Identities=54%  Similarity=0.891  Sum_probs=341.7

Q ss_pred             chhccCccc-ceeEEcCCHHHHHHHHHhhcCCeEEecCCceEEecCCeecCCCCCeeeecCCCccccccccC----cCcc
Q 011221          133 SVSDSSLKF-THVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MKNH  207 (490)
Q Consensus       133 ~l~~~gl~~-~~v~~Nls~~eL~e~A~~~~~g~~~t~~GaL~~~tG~~TGRSpkdk~iV~~~~t~~~i~wg~----~~e~  207 (490)
                      .+..+++.. ..|+||++.++|||+++++++|. +|++|+|++.||.+|||||||||||+++.+++.|||+.    |+++
T Consensus         9 ~~~~~~~~~~~~v~~n~s~~~L~e~~i~~~eg~-lt~~Gal~~~TG~~TGRSPkDkfiV~~~~t~~~i~W~~~Nkpi~~e   87 (529)
T COG1866           9 ELEALGIRDVEDVVYNLSAAQLYEEAIRRGEGV-LTATGALRVDTGIYTGRSPKDKFIVRDDSTRDTIWWGTRNKPISPE   87 (529)
T ss_pred             hHHHhcccchHHHHhcCCHHHHHHHHhhcCCCc-cCCCCceEEecccccCCCCCCceEEecCcccccccccccCccCCHH
Confidence            477888875 79999999999999999999995 99999999999999999999999999999999999994    5554


Q ss_pred             c--------------ccEEEEEeeecCCCCCeEEEEEEecccchHHHHhhcccCCChHhhccCCCCCEEEEEcCCCCCCc
Q 011221          208 D--------------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNR  273 (490)
Q Consensus       208 ~--------------~~lyv~D~~vG~d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~~~~~~pD~tI~~ap~f~~~~  273 (490)
                      .              +++||+|+++|+|+++++++|+|++.|||+||++||||||+.+++..| +|||+|+++|.|++++
T Consensus        88 ~f~~L~~~~~~yl~~k~lfv~d~~~Ga~~~~~l~vrvvte~Awh~lF~~nlfIrP~~e~l~~~-~~dftvin~p~f~~~~  166 (529)
T COG1866          88 TFDRLKGDVTDYLSGKDLFVVDGFAGADPDYRLPVRVVTEVAWHALFIRNLFIRPTGEELSTF-KPDFTVINAPSFKADP  166 (529)
T ss_pred             HHHHHHHHHHHHhccCcEEEEEeeecCCccceeeeEeehhhHHHHHHHHhcccccchhhhccC-CCCeEEEeCCcCCCCh
Confidence            2              789999999999999999999999999999999999999999999998 9999999999999999


Q ss_pred             cCCCCCcccEEEEecCCCeEEEEcccchhhhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCccccccc
Q 011221          274 YTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTD  353 (490)
Q Consensus       274 ~~~g~~s~~~i~id~~~~~~~I~Gt~Y~GEmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~~  353 (490)
                      ..+|++|+++|++|++++.++|+||.|+|||||++|++|||+||.+|+++||||||++..|++++|||||||||||||+|
T Consensus       167 ~~~g~~Se~~i~~n~~~~~~lIggT~YaGEMKK~~fs~mnylLP~~~i~~MHcsANvG~~gdvalFFGLSGTGKTTLSaD  246 (529)
T COG1866         167 KRDGLRSETFVAFNFTERIVLIGGTWYAGEMKKGIFSVMNYLLPLKGILSMHCSANVGEKGDVALFFGLSGTGKTTLSAD  246 (529)
T ss_pred             hhcccccccEEEEecccceeeeeccchhhhhhhhHHHHhhccccccccccceeccccCcCCCeEEEEeccCCCcceeccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCceeecCceeecCCCccccCcceEEeecCCCCCCCcchhhcccccceeeeeEEcCCCCeeecCCCCccccceEEEecc
Q 011221          354 HNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIE  433 (490)
Q Consensus       354 ~~~~lI~DD~~~wsd~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailENV~lD~~~~~vdf~d~s~T~NtRa~yPi~  433 (490)
                      |.|+||+||||+|+++||||||||||+|||+|++|+||+||+||++++|||||++|++ +.|||+|.|+|||||++|||+
T Consensus       247 p~R~LIGDDEHgW~d~GVFN~EGGCYAK~I~Ls~e~EP~I~~Ai~~~avLENVVvded-g~~Df~D~SlTeNTR~aYpi~  325 (529)
T COG1866         247 PHRRLIGDDEHGWDDRGVFNFEGGCYAKTINLSEEKEPEIYAAIKRGAVLENVVVDED-GTPDFDDGSLTENTRAAYPIE  325 (529)
T ss_pred             CccccccCcccccCCCceEeecCccccccccCchhhchhHHHHhhccceeeeEEEcCC-CCcCCccccccccccccchHh
Confidence            9999999999999999999999999999999999999999999999999999999997 899999999999999999999


Q ss_pred             cccCCCCCCCCCCccEEEEEEeecCCCCCCccccCHHHHHHHHHhccccccccccc
Q 011221          434 YIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVCAMSL  489 (490)
Q Consensus       434 ~i~N~~~~~~~g~P~~IIfLt~DafgvLPPVskLt~eQA~y~FlsGytakvagte~  489 (490)
                      +|||+.....++||++||||+|||||||||||||||||||||||||||||+||||.
T Consensus       326 ~Ipn~~~~~~~ghp~~iIfLTaDafGVlPPvsrLTpeQamYhFlsG~TaK~agTE~  381 (529)
T COG1866         326 HIPNVSPSVKAGHPKNVIFLTADAFGVLPPVSRLTPEQAMYHFLSGYTAKLAGTER  381 (529)
T ss_pred             hccccCcccccCCCceEEEEeccccCCCCcchhcCHHHHHHHHHcchhhhcccccc
Confidence            99997655667799999999999999999999999999999999999999999994


No 6  
>PF01293 PEPCK_ATP:  Phosphoenolpyruvate carboxykinase The Prosite pattern is specific to the ATP binding region;  InterPro: IPR001272  Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate. The ATP-utilising (4.1.1.49 from EC) and GTP-utilising (4.1.1.32 from EC) enzymes form two divergent subfamilies, which have little sequence similarity but which retain conserved active site residues. ATP-utilising PEPCKs are monomers or oligomers of identical subunits found in certain bacteria, yeast, trypanosomatids, and plants, while GTP-utilising PEPCKs are mainly monomers found in animals and some bacteria []. Both require divalent cations for activity, such as magnesium or manganese. One cation interacts with the enzyme at metal binding site 1 to elicit activation, while the second cation interacts at metal binding site 2 to serve as a metal-nucleotide substrate. In bacteria, fungi and plants, PEPCK is involved in the glyoxylate bypass, an alternative to the tricarboxylic acid cycle.  PEPCK helps to regulate blood glucose levels. The rate of gluconeogenesis can be controlled through transcriptional regulation of the PEPCK gene by cAMP (the mediator of glucagon and catecholamines), glucocorticoids and insulin. In general, PEPCK expression is induced by glucagon, catecholamines and glucocorticoids during periods of fasting and in response to stress, but is inhibited by (glucose-induced) insulin upon feeding []. With type II diabetes, this regulation system can fail, resulting in increased gluconeogenesis that in turn raises glucose levels []. PEPCK consists of an N-terminal and a catalytic C-terminal domain, with the active site and metal ions located in a cleft between them. Both domains have an alpha/beta topology that is partly similar to one another [, ]. Substrate binding causes PEPCK to undergo a conformational change, which accelerates catalysis by forcing bulk solvent molecules out of the active site []. PCK uses an alpha/beta/alpha motif for nucleotide binding, this motif differing from other kinase domains. GTP-utilising PEPCK has a PEP-binding domain and two kinase motifs to bind GTP and magnesium. This entry represents ATP-utilising phosphoenolpyruvate carboxykinase enzymes.; GO: 0004612 phosphoenolpyruvate carboxykinase (ATP) activity, 0005524 ATP binding, 0006094 gluconeogenesis; PDB: 2PY7_X 2OLR_A 1AYL_A 1K3D_A 1OEN_A 1AQ2_A 1OS1_A 2OLQ_A 1K3C_A 2PXZ_X ....
Probab=100.00  E-value=2.3e-116  Score=927.22  Aligned_cols=346  Identities=58%  Similarity=0.977  Sum_probs=297.0

Q ss_pred             ceeEEcCCHHHHHHHHHhhcCCeEEecCCceEEecCCeecCCCCCeeeecCCCccccccccC----cCccc---------
Q 011221          142 THVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MKNHD---------  208 (490)
Q Consensus       142 ~~v~~Nls~~eL~e~A~~~~~g~~~t~~GaL~~~tG~~TGRSpkdk~iV~~~~t~~~i~wg~----~~e~~---------  208 (490)
                      .+||||||++||||+|+++++|. ++++|+|+++||++|||||+|||||+++.++++|||++    |++++         
T Consensus         2 ~~v~~Nls~~~L~e~a~~~~eg~-lt~~Gal~v~tG~~TGRSp~dkfIV~~~~~~~~v~Wg~~n~~i~~e~f~~L~~~v~   80 (466)
T PF01293_consen    2 ANVYRNLSPPELYEEAIKRGEGV-LTKTGALVVNTGKFTGRSPKDKFIVDEPGTEDKVWWGSVNQPISEEQFEKLLERVV   80 (466)
T ss_dssp             SEEEES--HHHHHHHHCHTTTEE-E-TTSSEEE--TT-SSB-GGGEEEE-STTTTTTS-BTTSBEEE-HHHHHHHHHHHH
T ss_pred             CeeEeCCCHHHHHHHHHhcCCCE-EccCCCEEEeCCCccCCCCCceEEecCCccccccccccCCcccCHHHHHHHHHHHH
Confidence            47999999999999999999995 99999999999999999999999999999999999988    45432         


Q ss_pred             -----ccEEEEEeeecCCCCCeEEEEEEecccchHHHHhhcccCCChHhhccCCCCCEEEEEcCCCCCCccCCCCCcccE
Q 011221          209 -----VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTS  283 (490)
Q Consensus       209 -----~~lyv~D~~vG~d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~~~~~~pD~tI~~ap~f~~~~~~~g~~s~~~  283 (490)
                           ++|||+|++||+||++|++||+|++++||+||++|||++|..+|+.+| +||||||++|+|+++++.+|+.|+++
T Consensus        81 ~yL~~k~lyv~D~~vG~d~~~~~~vRvit~~a~~aLF~~nL~~~p~~~e~~~f-~pd~tI~~~p~f~~~p~~~g~~s~~~  159 (466)
T PF01293_consen   81 DYLSTKELYVQDGYVGADPDYRIKVRVITERAWHALFARNLFIRPPPEELQNF-EPDFTIINAPDFKADPEIDGTNSDTF  159 (466)
T ss_dssp             HHHTTSEEEEEEEEESSSTTT-EEEEEEESSHHHHHHHHHHSB-GSHHHHHT--S-SEEEEEETTS--TTCHCT-SSS-E
T ss_pred             HHhcccceEEEEEEEecCHHHceeEEEEeCcHHHHHHHHHhhcCCChhHhccc-CCCEEEEeCCccccCCCcCCCCCCcE
Confidence                 799999999999999999999999999999999999999999999999 99999999999999999999999999


Q ss_pred             EEEecCCCeEEEEcccchhhhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCcccccccCCCceeecCc
Q 011221          284 IDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDE  363 (490)
Q Consensus       284 i~id~~~~~~~I~Gt~Y~GEmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~~~~~~lI~DD~  363 (490)
                      |++|+++++++|+||+|+|||||++||+|||+++++|+||||||||++.+|++++|||||||||||||+|++|.||+||+
T Consensus       160 i~~d~~~~~~vI~Gt~Y~GEiKK~ift~~n~ll~~~g~l~mH~san~~~~gd~alfFGLSGTGKTTLs~d~~r~ligDDe  239 (466)
T PF01293_consen  160 IIFDFERNVAVILGTRYAGEIKKGIFTVMNYLLPRNGVLPMHCSANVGKDGDTALFFGLSGTGKTTLSADPERELIGDDE  239 (466)
T ss_dssp             EEEETTTTEEEEES---THHHHHHHHHHHHHHHHHTT-EEEEEEEEEETTSSEEEEEESTTSSHHHHHSBTTSEEEESSE
T ss_pred             EEEccccCeEEEECCcccccchHHHHHHHHHhhHhcCeEEEEeeeeeCCCCCeEEEEecCCCCccccccCCcceEEeCce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCccccCcceEEeecCCCCCCCcchhhcccccceeeeeEEcCCCCeeecCCCCccccceEEEecccccCCCCCCC
Q 011221          364 HCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCV  443 (490)
Q Consensus       364 ~~wsd~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailENV~lD~~~~~vdf~d~s~T~NtRa~yPi~~i~N~~~~~~  443 (490)
                      |+|+++|+||+|||||+||+||+++.||+||+|++|++|+|||++|+++++|||+|+++|+|||++|||++|||+..++.
T Consensus       240 ~~w~d~gv~~~EggcyaKt~~l~~~~ep~i~~ai~~~avlENV~~d~~~~~vd~~d~s~t~N~R~~~p~~~i~n~~~~~~  319 (466)
T PF01293_consen  240 HGWSDGGVFNFEGGCYAKTIDLSKESEPEIYNAIKFGAVLENVVVDEETREVDFDDDSITENTRAIYPREFIPNAVDPGD  319 (466)
T ss_dssp             EEEESSEEEES-SEEEEE-TT--TTTSHHHHHCCSTT-EEES-EEETTTSCEETT--SS-S--EEEEEGGGSSSB-SSSE
T ss_pred             eeecCCceEeecCceeeeecCCCcccchhHHHHhccCeeecceEEeCCCCccCCccccccCceeEEEEhhHhhccccccc
Confidence            99999999999999999999999999999999999999999999998899999999999999999999999999988888


Q ss_pred             CCCccEEEEEEeecCCCCCCccccCHHHHHHHHHhccccccccccc
Q 011221          444 GPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVCAMSL  489 (490)
Q Consensus       444 ~g~P~~IIfLt~DafgvLPPVskLt~eQA~y~FlsGytakvagte~  489 (490)
                      ++||++||||+||||||||||+|||+||||||||||||+|+||||.
T Consensus       320 ~~~p~~IifLt~Da~gvlPPvskLt~~qa~~~F~~G~t~k~agtE~  365 (466)
T PF01293_consen  320 GGHPKNIIFLTCDAFGVLPPVSKLTPEQAMYYFLSGYTAKVAGTER  365 (466)
T ss_dssp             ES-EEEEEEEE--TTS-S-SEEEE-HHHHHHHHHH-EEEEETTSBT
T ss_pred             cCCCCEEEEEECCCCCCCCcceeCCHHHHHHHHHHHHHhhhccccc
Confidence            8999999999999999999999999999999999999999999994


No 7  
>PRK09344 phosphoenolpyruvate carboxykinase; Provisional
Probab=100.00  E-value=1e-114  Score=921.35  Aligned_cols=353  Identities=55%  Similarity=0.913  Sum_probs=342.9

Q ss_pred             hhccCccc-ceeEEcCCHHHHHHHHHhhcCCeEEecCCceEEecCCeecCCCCCeeeecCCCccccccccC----cCccc
Q 011221          134 VSDSSLKF-THVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK----MKNHD  208 (490)
Q Consensus       134 l~~~gl~~-~~v~~Nls~~eL~e~A~~~~~g~~~t~~GaL~~~tG~~TGRSpkdk~iV~~~~t~~~i~wg~----~~e~~  208 (490)
                      |...||.+ .+++|||++++|||+|+++++|. +|++|+|+++||++|||||+|||||+++.++++||||+    |++++
T Consensus         8 l~~~g~~~~~~i~~n~~~~~L~e~a~~~~~g~-~t~~Gal~~~tG~~tGRSp~dk~iV~~~~~~~~i~wg~~n~~~~~~~   86 (526)
T PRK09344          8 LEAYGITNLSNVHYNLSYAELYEEALRRGEGV-LTDTGALAVDTGKFTGRSPKDKFIVRDPSTEDTIWWGDDNKPISPEK   86 (526)
T ss_pred             hhhcCCCCcceeEeCCCHHHHHHHHHHcCCCe-eccCCceEEecCCccCCCcCceeeecCccccccccccccCCCCCHHH
Confidence            77889987 79999999999999999999995 99999999999999999999999999999999999998    55432


Q ss_pred             --------------ccEEEEEeeecCCCCCeEEEEEEecccchHHHHhhcccCCChHhhccCCCCCEEEEEcCCCCCCcc
Q 011221          209 --------------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRY  274 (490)
Q Consensus       209 --------------~~lyv~D~~vG~d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~~~~~~pD~tI~~ap~f~~~~~  274 (490)
                                    ++|||+|+++|+||+|+++||++++++||+||++|||++|+.+|++.+ +|||+||++|+|+++|.
T Consensus        87 f~~l~~~~~~~l~~~~lyv~d~~vG~d~~~~~~vrvi~~~a~~~lf~~nlf~~p~~~e~~~~-~Pd~~ii~~p~~~~~~~  165 (526)
T PRK09344         87 FDALKQKVLAYLSGKDLFVVDGFAGADPEYRLPVRVITELAWHALFVRNLFIRPSEEELASF-EPDFTIINAPKFKADPE  165 (526)
T ss_pred             HHHHHHHHHHHhcCCcEEEEeeeecCChhHeeeEEEEecHHHHHHHHhhcCCCCChhHhccC-CCCEEEEEcCCCCCCcc
Confidence                          789999999999999999999999999999999999999999999988 99999999999999999


Q ss_pred             CCCCCcccEEEEecCCCeEEEEcccchhhhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCcccccccC
Q 011221          275 THYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDH  354 (490)
Q Consensus       275 ~~g~~s~~~i~id~~~~~~~I~Gt~Y~GEmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~~~  354 (490)
                      .+|++|+++|++|+++++++|+||+|+|||||++||+||+++++||+||||||||++.+|++++||||||||||||++++
T Consensus       166 ~~g~~s~~~i~~~~~~~~~~I~Gt~Y~GE~KK~~lt~~~~~l~~rg~l~lH~sa~i~~~g~~~~ffGlSGtGKSTls~~~  245 (526)
T PRK09344        166 RDGTNSETFIAINFTERIVLIGGTDYAGEMKKSIFSVMNYLLPLKGVLPMHCSANVGEEGDVALFFGLSGTGKTTLSADP  245 (526)
T ss_pred             ccCCCCCceEEEecccCeEEEEcchhHHHHHHHHHHHHHHHHHHCCcEeeeCeeecCCCCcEEEEEeecCCCeeeccccC
Confidence            99999999999999999999999999999999999999999999999999999999988999999999999999999999


Q ss_pred             CCceeecCceeecCCCccccCcceEEeecCCCCCCCcchhhcccccceeeeeEEcCCCCeeecCCCCccccceEEEeccc
Q 011221          355 NRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEY  434 (490)
Q Consensus       355 ~~~lI~DD~~~wsd~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailENV~lD~~~~~vdf~d~s~T~NtRa~yPi~~  434 (490)
                      ++.||+||+|+|+|+|+||+|+|||+||+||+++.||+||+|++|++|+|||++|+ ++.|||+|+++|+|||++||+++
T Consensus       246 ~~~li~DD~~~~~d~gvfn~EgGcyaK~~dL~~~~EP~I~~a~~~gavlENV~~d~-~~~vdf~d~s~T~NtR~~yP~~~  324 (526)
T PRK09344        246 NRKLIGDDEHGWDDGGVFNFEGGCYAKTINLSEEAEPEIYDAIRFGAVLENVVVDE-DGTVDFDDGSLTENTRAAYPIEH  324 (526)
T ss_pred             CcceeccceEEEcCCceEeccceEEEEecCCCccccchHhhhhccCceeeeEEECC-CCcccCCCCcccccceEEEEhHH
Confidence            99999999999999999999999999999999999999999999999999999999 78999999999999999999999


Q ss_pred             ccCCCCCCCCCCccEEEEEEeecCCCCCCccccCHHHHHHHHHhccccccccccc
Q 011221          435 IPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVCAMSL  489 (490)
Q Consensus       435 i~N~~~~~~~g~P~~IIfLt~DafgvLPPVskLt~eQA~y~FlsGytakvagte~  489 (490)
                      |+|+..++.++||++||||+||+|||||||+||||||||||||||||||+||||.
T Consensus       325 i~n~~~~~~~~~p~~iifLt~Da~gvlPPvskLt~eQA~y~FlsGyTak~agtE~  379 (526)
T PRK09344        325 IPNAVKPSRAGHPKNIIFLTADAFGVLPPVSKLTPEQAMYHFLSGYTAKVAGTER  379 (526)
T ss_pred             hcCccccccCCCCCEEEEEEcCCcCCCCcceeCCHHHHHHHHHcCceeccccccc
Confidence            9999999999999999999999999999999999999999999999999999994


No 8  
>cd01919 PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).
Probab=100.00  E-value=3.1e-99  Score=803.97  Aligned_cols=345  Identities=41%  Similarity=0.608  Sum_probs=329.1

Q ss_pred             eeEEcCCHHHHHHHHHhh-cCCeEEecCCceEEecCCeecCCCCCeeeecCCCccccccc----cC----cCccc-----
Q 011221          143 HVLYNLSPAELYEQAIKY-EQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWW----GK----MKNHD-----  208 (490)
Q Consensus       143 ~v~~Nls~~eL~e~A~~~-~~g~~~t~~GaL~~~tG~~TGRSpkdk~iV~~~~t~~~i~w----g~----~~e~~-----  208 (490)
                      .|+||++.++|||+|+++ ++| +++++|+|++.||++|||||+|||||+++.+++.+||    ++    |+++.     
T Consensus         2 ~v~~n~~~~~L~e~~~~~~g~~-~~~~~g~l~~~tg~~tgRsp~dkfIv~~~~~~~~~~w~~~w~~~N~~~~~~~~~~~~   80 (515)
T cd01919           2 HIHINDENGRLLQQMLEEYGIL-RLTKNGALAVTDPRDTGRSPSDKVIVTQDQRRTVPIPKTGLSQLNRWLSEEDFEKAF   80 (515)
T ss_pred             ceEECCCHHHHHHHHHHhcCCE-EECCCceEEECCCCccccCCCceEEeCCCccccCccccccccccCCCCCHHHHHHHH
Confidence            589999999999999999 777 5999999999999999999999999999999999995    54    44432     


Q ss_pred             ----------ccEEEEEeeecCCCCCeEEEEEEecccchHHHHhhcccCCChHhhccCCCCCEEEEEcCCCCCCccC-CC
Q 011221          209 ----------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYT-HY  277 (490)
Q Consensus       209 ----------~~lyv~D~~vG~d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~~~~~~pD~tI~~ap~f~~~~~~-~g  277 (490)
                                ++|||+|+++|+||.+++++|+||++|||+|||+|||++|..+|++.|++|||++|++|.|++++.. +|
T Consensus        81 ~~~~~~~m~gr~myV~d~~~G~~~~~~~~~r~it~~ay~~lf~~~m~~~p~~~~l~~~~~p~~~ii~~~g~~~~~~~w~g  160 (515)
T cd01919          81 NARFPGLMKGRTLFVVDFFMGPGSPLRLIVRELTDSPYVAAFMRIMTIMPTDEELAAFGDPDVKCLNSVGCPLPLQKWPG  160 (515)
T ss_pred             HHHHHHHhcCCCEEEEeceECCCCcccccEEEEEChHHHHHHHHHhccCCChHHHhhCCCCCEEEEeCCCCcCCccCCCC
Confidence                      7899999999999999999999999999999999999999989999997799999999999999987 89


Q ss_pred             CCcccEEEEecCCCeEEEEcccchhhhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCcccccccCCCc
Q 011221          278 MTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRY  357 (490)
Q Consensus       278 ~~s~~~i~id~~~~~~~I~Gt~Y~GEmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~~~~~~  357 (490)
                      +.|+++|++|+++++++|+||+|+|||||++||+|+++++++|+|+||||++++++|++++||||||||||||++++++.
T Consensus       161 ~~s~~~I~~~~~~~~i~i~Gt~Y~Ge~KK~~l~~~~~l~~~~g~L~~H~s~~~~~~g~~~~~~GlSGtGKTTLa~~~~~~  240 (515)
T cd01919         161 LPSLTLVAHNPDRREQIIFGTGYGGEMKKGFLRMMSRLAPEEGWLAMHMSANVGTNGDVLVFFGLSGTGKTTLSMDPKRE  240 (515)
T ss_pred             CCCCcEEEEEcccCEEEEecCccccchHHHHHHHHHHHHHhcCceeeeceeeccCCCCEEEEEecccCCCcccccCCCcC
Confidence            99999999999999999999999999999999999999999999999999988899999999999999999999999999


Q ss_pred             eeecCceeecCCCccccCcceEEeecCCCCCCCcchhhcccccceeeeeEEcCCCCeeecCCCCccccceEEEecccccC
Q 011221          358 LIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPN  437 (490)
Q Consensus       358 lI~DD~~~wsd~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailENV~lD~~~~~vdf~d~s~T~NtRa~yPi~~i~N  437 (490)
                      +|+||++.|+++|+||+|+|||+||+||+++.||+||+|++|++|+|||.+|++ +.|+|+|.++|+|+|++||+++|||
T Consensus       241 ligDD~~~w~~~gv~N~EgGcyak~~gls~e~eP~i~~ai~~~aileNV~~d~~-g~v~~~~~s~t~NtR~~yP~~~i~n  319 (515)
T cd01919         241 LIGDDEHWWKDDGVFNPEGGCYAKAIGLSVKTEPNIYKAIRKNAIFENVAETSD-GGIDFEDISAHPNTRVCYPASHIPI  319 (515)
T ss_pred             eecccEEEEeCCCEEecCCceEEEecCCCcccCHHHHHHhcCCcEEEeeeEcCC-CCEeCCCCCCCchheEEeEHHhCCC
Confidence            999999999999999999999999999999999999999999999999999995 6889999999999999999999999


Q ss_pred             CCCC-CCCCCccEEEEEEeecCCCCCCccccCHHHHHHHHHhccccccccccc
Q 011221          438 AKIP-CVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVCAMSL  489 (490)
Q Consensus       438 ~~~~-~~~g~P~~IIfLt~DafgvLPPVskLt~eQA~y~FlsGytakvagte~  489 (490)
                      +..+ ..++||++||||+||||||||||+||++|||||||+||||+|+||||.
T Consensus       320 ~~~~~~~g~~~~~IiFltrda~gvlPpV~~lt~eqavy~f~sg~T~ktAgtea  372 (515)
T cd01919         320 IDAAWESAGHIEGVIFLTRDAFGVVPPVYRLTWQQGVFVFAAGRTAATAGTEA  372 (515)
T ss_pred             CCCccccCCCccEEEEEecCCCCCCCcEEEccHHHHHHHHHhhhhhhhcchhc
Confidence            9766 457899999999999999999999999999999999999999999873


No 9  
>cd00819 PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity, this model describes the GTP-dependent group.
Probab=99.92  E-value=1.3e-23  Score=225.07  Aligned_cols=319  Identities=19%  Similarity=0.254  Sum_probs=232.9

Q ss_pred             ccceeEEcC-CHHH---HHHHHHhhcCCeEEec-CCceEEecC-CeecCCCCCeeeecCCCcc--ccccccC---cCcc-
Q 011221          140 KFTHVLYNL-SPAE---LYEQAIKYEQGSFIAS-SGALATLSG-AKTGRSPRDKRVVKDETTE--HELWWGK---MKNH-  207 (490)
Q Consensus       140 ~~~~v~~Nl-s~~e---L~e~A~~~~~g~~~t~-~GaL~~~tG-~~TGRSpkdk~iV~~~~t~--~~i~wg~---~~e~-  207 (490)
                      .|.+||+.. |.+|   |.+++++.++-..+.. -|..++.|. .=..|.=+.+||.-+...+  ....|-.   |.++ 
T Consensus        13 ~Pd~v~~cdGS~ee~~~l~~~~v~~G~~~~L~~~~~~~l~rs~p~DvARve~rTfI~s~~~~dagp~nnw~~p~e~~~~l   92 (579)
T cd00819          13 QPDSVYICDGSEEEYDRLRDLMVEQGEEIRLNKYPNSYLARSDPSDVARVESRTFICSEDEEDAGPTNNWMDPEEMKAEL   92 (579)
T ss_pred             CCCEEEEcCCCHHHHHHHHHHHHhcCcEeeCCCCCCCEEEeCCccccceeccceEEecCchhccCCccccCCHHHHHHHH
Confidence            368999876 4443   6667776533322211 233333332 2245555566888754433  2334643   2211 


Q ss_pred             ---------cccEEEEEeeecC-CCCCeEEEEEEecccchHHHHhhcccCCChHhhccCCCCCEE--EEEcCC-------
Q 011221          208 ---------DVQVFVNDQFLNW-DPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFT--IYNAGQ-------  268 (490)
Q Consensus       208 ---------~~~lyv~D~~vG~-d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~~~~~~pD~t--I~~ap~-------  268 (490)
                               -|.|||.-=.+|- .+.+....-.||+++|..+.|+-|. |-....+...+..+|+  |++...       
T Consensus        93 ~~lf~G~M~GRTMYVipfsmGP~gSp~s~~gVqiTDS~YVv~sm~imt-R~g~~vl~~lg~~~Fv~~vHSvG~pl~~~~~  171 (579)
T cd00819          93 KELFKGCMRGRTMYVIPFSMGPLGSPISKIGVELTDSPYVVHSMRIMT-RMGKAVLDALGEGEFVPCLHSVGAPLSAGQK  171 (579)
T ss_pred             HhhCCcccCCCeEEEEeeecCCCCCCcccceEEEeCCHHHHHhHHHHH-hcCHHHHHhcCcCCeeeeeccCCCcCCCCCC
Confidence                     2899997666665 7778888899999999999877544 5555666555445665  333332       


Q ss_pred             --CCCCccCCCCCcccEEEEecCCCeEEEEcccchhhh---HHHH-HHHHHHhcccCCeeeeccccccC---CCCCEEEE
Q 011221          269 --FPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEM---KKGL-FSVMHYLMPKRQILSLHSGCNMG---KDGDVALF  339 (490)
Q Consensus       269 --f~~~~~~~g~~s~~~i~id~~~~~~~I~Gt~Y~GEm---KK~i-ltl~~~~l~~~G~L~~H~sani~---~~g~~~lf  339 (490)
                        |++|+      ..+.|+++++.++|+..|+.|.|+-   ||.. |+++.++..++|+|+.|+-. ++   .+|+...|
T Consensus       172 ~~wpcn~------~~~~I~h~pe~~~I~S~gSgYGGNaLlgKKcfaLRiAs~~ar~eGWLAEHMlI-lgvt~P~G~~~yv  244 (579)
T cd00819         172 DVWPCNP------EKKYIVHFPEEREIWSFGSGYGGNALLGKKCFALRIASVMARDEGWLAEHMLI-LGVTNPEGEKKYF  244 (579)
T ss_pred             CCCCCCC------CccEEEEEcCCCeEEEecCCcCCCcccchhHHHHHHHHHHhHhcCcHHHhhHH-heeeCCCCCEEEE
Confidence              33322      2478999999999999999999996   9997 99999999999999999974 43   56777666


Q ss_pred             Ee--CCCCCcccccc-cC---C--CceeecCcee--ecCCCcc---ccCcceEEeecCCCCCCCcchhhcccccceeeee
Q 011221          340 FG--LSGTGKTTLST-DH---N--RYLIGDDEHC--WGDNGVS---NIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENV  406 (490)
Q Consensus       340 fG--lSGtGKTTLs~-~~---~--~~lI~DD~~~--wsd~Gvf---n~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailENV  406 (490)
                      .|  +|+||||+|++ .|   +  -.+|+||+.-  +.+||..   |.|.|+|..+.|.+.+..|.++++++-++|+.||
T Consensus       245 aaAFPSaCGKTnlAMl~p~~~gwkv~~vGDDIAwm~~~~dG~l~AINPE~GfFGVapGtn~~tnP~am~~l~~n~IFTNV  324 (579)
T cd00819         245 AAAFPSACGKTNLAMLIPPLPGWKVETVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTNAKTNPNAMATLHKNTIFTNV  324 (579)
T ss_pred             EEEcccccccccHhhcCCCCCCceeEEeccceeeeEECCCCcEEEEcCCCCeeEeCCCCCCCcCHHHHHHhcCCceEEEE
Confidence            66  99999999998 32   2  3489999864  3367964   8999999999999999999999999999999999


Q ss_pred             EEcCCCCeeecCCCCc-------------------------cccceEEEecccccCCC--CCCCCCCccEEEEEE-eecC
Q 011221          407 VFDEHTREVDYSDKSV-------------------------TENTRAAYPIEYIPNAK--IPCVGPHPKNVILLA-CDAF  458 (490)
Q Consensus       407 ~lD~~~~~vdf~d~s~-------------------------T~NtRa~yPi~~i~N~~--~~~~~g~P~~IIfLt-~Daf  458 (490)
                      .++++ +.|-|.+...                         +.|+|.+.|+...|++.  .+...|.|++.|++. +| .
T Consensus       325 a~t~D-G~vwWeG~~~e~p~~~~~w~~~G~~w~~~~~~paAHPNsRFt~p~~q~p~idp~wedP~GVpI~aiiFGGRr-~  402 (579)
T cd00819         325 ALTED-GDVWWEGLTEEPPEHLTDWQGLGKRWTPGDGEPAAHPNSRFTAPASQCPNIDPEWENPEGVPIDAIIFGGRR-P  402 (579)
T ss_pred             eEcCC-CCeeCCCCCCCCCCceeeccCCCCCCCCCCCCcCCCCcccccccHHHCCcCCccccCCCCCEEEEEEECCcC-C
Confidence            99886 4787776544                         89999999999999985  445668899888777 55 5


Q ss_pred             CCCCCccccC
Q 011221          459 GVLPPVSKLN  468 (490)
Q Consensus       459 gvLPPVskLt  468 (490)
                      ..+|+|....
T Consensus       403 ~tvPlV~ea~  412 (579)
T cd00819         403 DTVPLVYEAF  412 (579)
T ss_pred             CCCCeEEEcc
Confidence            6889998654


No 10 
>PRK04210 phosphoenolpyruvate carboxykinase; Provisional
Probab=99.90  E-value=2.8e-22  Score=215.24  Aligned_cols=323  Identities=18%  Similarity=0.210  Sum_probs=227.5

Q ss_pred             ccceeEEcC-CHH---HHHHHHHhhcCCeEEecC------CceEEecCC-eecCCCCCeeeecCCCcc--ccccccC---
Q 011221          140 KFTHVLYNL-SPA---ELYEQAIKYEQGSFIASS------GALATLSGA-KTGRSPRDKRVVKDETTE--HELWWGK---  203 (490)
Q Consensus       140 ~~~~v~~Nl-s~~---eL~e~A~~~~~g~~~t~~------GaL~~~tG~-~TGRSpkdk~iV~~~~t~--~~i~wg~---  203 (490)
                      .|..||++- |.+   .|.+++++.  |+ +...      +...+.|.. =..|.=..+||.-+...+  ....|-.   
T Consensus        25 ~Pd~v~~cdGS~ee~~~l~~~~v~~--G~-~~~L~~~k~~~~~~~rsdp~DvARve~rTfI~s~~~~dagp~nnw~~p~e  101 (601)
T PRK04210         25 QPDRVVWCDGSEEEYDRLRDQAVEA--GT-EIKLNPEKRPNSFLARSDPSDVARVEDRTFICSEKEEDAGPTNNWMDPAE  101 (601)
T ss_pred             CCCEEEEeCCCHHHHHHHHHHHHHc--CC-EeeccCCCCCceeeccCChhhhhhcccceEEecCchhhcCCccCcCCHHH
Confidence            378999977 544   377777765  43 2222      222222221 134444456887764433  2334644   


Q ss_pred             cCcc----------cccEEEEEeeecC-CCCCeEEEEEEecccchHHHHhhcccCCChHhhccCC-CCCEE--EEEcCCC
Q 011221          204 MKNH----------DVQVFVNDQFLNW-DPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFG-TPDFT--IYNAGQF  269 (490)
Q Consensus       204 ~~e~----------~~~lyv~D~~vG~-d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~~~~~-~pD~t--I~~ap~f  269 (490)
                      |.++          -|.|||.-=.+|- .+.+....-.||+++|..+.|+-| .|-..+.++..+ ..+|+  |++...-
T Consensus       102 ~~~~l~~lf~G~M~GRTMyVipfsmGP~gSp~s~~gVqiTDS~YVv~sm~im-tR~g~~~l~~l~~~~~Fv~~vHSvG~p  180 (601)
T PRK04210        102 MRETLKGLFKGCMRGRTMYVVPFSMGPLGSPFAKIGVEITDSPYVVHSMRIM-TRMGKAVLDVLGEDGEFVPCVHSVGAP  180 (601)
T ss_pred             HHHHHHHhcCCccCCCeEEEeeeeeCCCCCCcccceEEeeCCHHHHHhHHHH-HhccHHHHHhhCCCCceeeeeccCCCC
Confidence            2221          2899997655555 778888899999999999987754 455566665554 34665  3444321


Q ss_pred             CCCccCC---CCCcccEEEEecCCCeEEEEcccchhhh----HHHHHHHHHHhcccCCeeeeccccccC---CCCCEEEE
Q 011221          270 PCNRYTH---YMTSSTSIDLNLARREMVILGTQYAGEM----KKGLFSVMHYLMPKRQILSLHSGCNMG---KDGDVALF  339 (490)
Q Consensus       270 ~~~~~~~---g~~s~~~i~id~~~~~~~I~Gt~Y~GEm----KK~iltl~~~~l~~~G~L~~H~sani~---~~g~~~lf  339 (490)
                      ......+   ..+.+..|+.-++.++|+..|++|.|+-    ||..|+++.++..++|+|+.|+-. ++   .+|++..|
T Consensus       181 ~~~~~~~v~wpcn~~r~i~h~pe~~~I~S~gSgYgGNaLLGkKc~ALRiAs~~ar~eGWLAEHMlI-lgvt~P~G~~~yv  259 (601)
T PRK04210        181 LEPGQKDVPWPCNDTKYIVHFPETREIWSYGSGYGGNALLGKKCFALRIASVMARDEGWLAEHMLI-LGVTSPEGRKTYF  259 (601)
T ss_pred             CCCCCCCCCCCCCCCeEEEEeCCCcEEEEecCCCCCCccchhHHHHHHHHHHHhHhcccHHHhhHH-heeeCCCCCEEEE
Confidence            1100000   1112344444456779999999999994    999999999999999999999974 43   67888777


Q ss_pred             Ee--CCCCCccccccc-C---CC--ceeecCceee--cCCCcc---ccCcceEEeecCCCCCCCcchhhcccc-cceeee
Q 011221          340 FG--LSGTGKTTLSTD-H---NR--YLIGDDEHCW--GDNGVS---NIEGGCYAKCIDLSREKEPDIWNAIKF-GAVLEN  405 (490)
Q Consensus       340 fG--lSGtGKTTLs~~-~---~~--~lI~DD~~~w--sd~Gvf---n~EgGcYaK~~dLs~e~eP~I~~Ai~f-~ailEN  405 (490)
                      .|  +|+||||+|++. +   +-  ..||||+.-+  ..||.+   |.|.|+|..+.|.+.+..|.++++++. ++|+.|
T Consensus       260 aaAFPSaCGKTnlAMl~p~~~gwkv~~VGDDIAwm~~~~dG~l~AiNPE~GfFGVapGtn~~tnP~am~~l~~~n~IFTN  339 (601)
T PRK04210        260 AAAFPSACGKTNLAMLIPPIPGWKVETVGDDIAWIRPGEDGRLYAINPEAGFFGVAPGTNEKTNPNAMATLKPGNVIFTN  339 (601)
T ss_pred             EEecccccccccHhhcCCCCCCceeEEeecceeeeeECCCCcEEEEccCCCeeEeCCCCCCCcCHHHHHhcccCCeEEee
Confidence            76  999999999993 2   22  3799998643  379964   889999999999999999999999987 999999


Q ss_pred             eEEcCCCCeeecCCCC-----------------------ccccceEEEecccccCCC--CCCCCCCccEEEEEEeecCCC
Q 011221          406 VVFDEHTREVDYSDKS-----------------------VTENTRAAYPIEYIPNAK--IPCVGPHPKNVILLACDAFGV  460 (490)
Q Consensus       406 V~lD~~~~~vdf~d~s-----------------------~T~NtRa~yPi~~i~N~~--~~~~~g~P~~IIfLt~Dafgv  460 (490)
                      |.++++ +.|-+.+..                       .+.|+|.+.|+...||+.  .+...|.|++.|++.-+....
T Consensus       340 Valt~D-G~vwWeG~~~~~P~~~~dw~G~~W~p~~~~paaHPNsRFt~p~~q~p~idp~wedP~GVpIsaiiFGGRr~~t  418 (601)
T PRK04210        340 VALTDD-GDVWWEGMTEEPPAHLIDWQGNDWTPGSGEPAAHPNARFTVPASQCPNLDPEWEDPAGVPISAIIFGGRRSDT  418 (601)
T ss_pred             eEECCC-CCeecCCCCCCCCCcccccCCCcCCCCCCCCCCCCccceeccHHHCCcCCccccCCCCCEEEEEEECCcCCCC
Confidence            999885 467665443                       789999999999999985  446679999888877333678


Q ss_pred             CCCccccC
Q 011221          461 LPPVSKLN  468 (490)
Q Consensus       461 LPPVskLt  468 (490)
                      +|||....
T Consensus       419 ~PlV~ea~  426 (601)
T PRK04210        419 VPLVTEAF  426 (601)
T ss_pred             CCeeEEcc
Confidence            89998654


No 11 
>PF00821 PEPCK:  Phosphoenolpyruvate carboxykinase;  InterPro: IPR008209  Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate. The ATP-utilising (4.1.1.49 from EC) and GTP-utilising (4.1.1.32 from EC) enzymes form two divergent subfamilies, which have little sequence similarity but which retain conserved active site residues. ATP-utilising PEPCKs are monomers or oligomers of identical subunits found in certain bacteria, yeast, trypanosomatids, and plants, while GTP-utilising PEPCKs are mainly monomers found in animals and some bacteria []. Both require divalent cations for activity, such as magnesium or manganese. One cation interacts with the enzyme at metal binding site 1 to elicit activation, while the second cation interacts at metal binding site 2 to serve as a metal-nucleotide substrate. In bacteria, fungi and plants, PEPCK is involved in the glyoxylate bypass, an alternative to the tricarboxylic acid cycle.  PEPCK helps to regulate blood glucose levels. The rate of gluconeogenesis can be controlled through transcriptional regulation of the PEPCK gene by cAMP (the mediator of glucagon and catecholamines), glucocorticoids and insulin. In general, PEPCK expression is induced by glucagon, catecholamines and glucocorticoids during periods of fasting and in response to stress, but is inhibited by (glucose-induced) insulin upon feeding []. With type II diabetes, this regulation system can fail, resulting in increased gluconeogenesis that in turn raises glucose levels []. PEPCK consists of an N-terminal and a catalytic C-terminal domain, with the active site and metal ions located in a cleft between them. Both domains have an alpha/beta topology that is partly similar to one another [, ]. Substrate binding causes PEPCK to undergo a conformational change, which accelerates catalysis by forcing bulk solvent molecules out of the active site []. PCK uses an alpha/beta/alpha motif for nucleotide binding, this motif differing from other kinase domains. GTP-utilising PEPCK has a PEP-binding domain and two kinase motifs to bind GTP and magnesium. This entry represents GTP-utilising phosphoenolpyruvate carboxykinase enzymes.; GO: 0004611 phosphoenolpyruvate carboxykinase activity, 0005525 GTP binding, 0006094 gluconeogenesis; PDB: 2FAH_A 2FAF_A 2QZY_B 2ZCI_D 3MOE_A 3DT7_B 2RKD_A 2RKA_A 2RK8_A 2QF2_B ....
Probab=99.86  E-value=4.8e-21  Score=206.15  Aligned_cols=325  Identities=18%  Similarity=0.239  Sum_probs=206.0

Q ss_pred             ccceeEEcC-CHH---HHHHHHHhhcCCeEEecCC----ceEEecCCeecCCCCCeeeecCCCcc--ccccccC---cCc
Q 011221          140 KFTHVLYNL-SPA---ELYEQAIKYEQGSFIASSG----ALATLSGAKTGRSPRDKRVVKDETTE--HELWWGK---MKN  206 (490)
Q Consensus       140 ~~~~v~~Nl-s~~---eL~e~A~~~~~g~~~t~~G----aL~~~tG~~TGRSpkdk~iV~~~~t~--~~i~wg~---~~e  206 (490)
                      .|..||+.- |.+   +|.+++++.++-..+...+    -|....-.=.+|.-..+||.-+...+  ....|-.   |..
T Consensus        11 ~P~~I~icdGS~eE~~~l~~~~~~~G~~~~L~~~~~~n~~l~~sdp~DvARve~~TfI~t~~~~d~~p~~nw~~~~~~~~   90 (586)
T PF00821_consen   11 QPDSIYICDGSEEENDRLRDELVEQGEEIPLNPPKHPNCYLHRSDPSDVARVESRTFICTEDKEDAGPTNNWMDPEEMKA   90 (586)
T ss_dssp             -BSEEEE----HHHHHHHHHHHHHTTSEEEE-TTTSBSEEEE---TTSSS--GGGEEEE-SSHHHHSTTSSEE-HHHHHH
T ss_pred             CCCEEEEcCCCHHHHHHHHHHHHHcCCEEeCCCCCCCCcEEEecCccccceecCceEEEcCCccccCCccCCCCHHHHHH
Confidence            367888755 444   4667776542222221112    22222222356666677888665433  2334644   211


Q ss_pred             c----------cccEEEEEeeecC-CCCCeEEEEEEecccchHHHHhhcccCCChHhhccCC-CCCEE--EEEcCC----
Q 011221          207 H----------DVQVFVNDQFLNW-DPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFG-TPDFT--IYNAGQ----  268 (490)
Q Consensus       207 ~----------~~~lyv~D~~vG~-d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~~~~~-~pD~t--I~~ap~----  268 (490)
                      +          -|.|||.-=.+|- ...+....-.+|+++|..+.|+-| .|-..+.+...+ ..+|+  |++...    
T Consensus        91 ~l~~~f~G~M~GRtMyVipfsmGP~gsp~s~~gVqlTDS~YVv~sm~im-tR~g~~v~~~l~~~~~Fv~~vHSvG~pl~~  169 (586)
T PF00821_consen   91 ELDELFPGCMKGRTMYVIPFSMGPIGSPFSKIGVQLTDSPYVVHSMRIM-TRMGYAVLDRLGDDGEFVRCVHSVGAPLPP  169 (586)
T ss_dssp             HHHCCSTTTTTTSEEEEEEEEESSTTSTT-EEEEEEES-HHHHHHHHHH-SEESHHHHHHHTTT--SEEEEEE-S--SST
T ss_pred             HHHHhchhhhhhchHHhhHhhhCCCCCCCccceEEccCcHHHHHhHHHH-HhcCHHHHHHhCCCCceEeeecccCCcCCC
Confidence            1          2899997666665 888888899999999999987754 455555554443 33664  555542    


Q ss_pred             ------CCCCccCCCCCcccEEEEecCCCeEEEEcccchhh---hHH-HHHHHHHHhcccCCeeeeccccccC---CCCC
Q 011221          269 ------FPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGE---MKK-GLFSVMHYLMPKRQILSLHSGCNMG---KDGD  335 (490)
Q Consensus       269 ------f~~~~~~~g~~s~~~i~id~~~~~~~I~Gt~Y~GE---mKK-~iltl~~~~l~~~G~L~~H~sani~---~~g~  335 (490)
                            |++|+      ..++|+.++++++|+..|+.|.|+   .|| ..|+++.++..++|+|+.|+-. ++   .+|+
T Consensus       170 ~~~~~~wpcn~------~~~~I~h~p~~~~I~S~gsgYGGNaLlgKKc~aLRiAs~~ar~eGWLAEHMlI-lgit~P~G~  242 (586)
T PF00821_consen  170 GQKDVNWPCNP------DKRYIVHFPEEREIWSFGSGYGGNALLGKKCFALRIASVIARDEGWLAEHMLI-LGITNPEGR  242 (586)
T ss_dssp             SS--BTB---G------GG-EEEEECCCTEEEEES--SHHHHSTCCCCCCCHHHHHHHHHHT-EEESEEE-EEEE-TTS-
T ss_pred             CCCCCCCCCCc------cceEEEEECCCCeEEEeCCCcCcchhhhhhhhhHHHHHHHHHhhhHHhhhhhe-eeEecCCCC
Confidence                  33332      358999999999999999999999   899 8999999999999999999985 43   6799


Q ss_pred             EEEEEe--CCCCCccccccc-C---CC--ceeecCcee--ecCCCcc---ccCcceEEeecCCCCCCCcchhhcccccce
Q 011221          336 VALFFG--LSGTGKTTLSTD-H---NR--YLIGDDEHC--WGDNGVS---NIEGGCYAKCIDLSREKEPDIWNAIKFGAV  402 (490)
Q Consensus       336 ~~lffG--lSGtGKTTLs~~-~---~~--~lI~DD~~~--wsd~Gvf---n~EgGcYaK~~dLs~e~eP~I~~Ai~f~ai  402 (490)
                      +..|.|  +|+||||+|++. |   +-  ..||||+.-  ++.||..   |.|.|+|.-.-|.+.+..|.+++++.-++|
T Consensus       243 ~~yiaaAFPSaCGKTnlAMl~p~~pGwkve~VGDDIAWmr~~~dG~lrAiNPE~GfFGVapGtn~~tnP~am~~l~~ntI  322 (586)
T PF00821_consen  243 KTYIAAAFPSACGKTNLAMLQPTLPGWKVETVGDDIAWMRFGEDGRLRAINPENGFFGVAPGTNMKTNPNAMATLGKNTI  322 (586)
T ss_dssp             EEEEEEE-TTTSSHHHHHT---SSTT-EEEEEESS-EEEEE-TTSBEEEE---SEEEEE-TT-STTT-HHHHHHTTBSEE
T ss_pred             EEEEEEecCcccccccHHhcCCCCCCcEEEEeeccchheeEcCCCcEEEeecccceEEeccCCCCCCCHHHHHHhhccce
Confidence            988886  999999999993 2   22  379999853  4489964   999999999999999999999999999999


Q ss_pred             eeeeEEcCCCCeeecC--------------CC---------CccccceEEEecccccCCC--CCCCCCCccEEEEEE-ee
Q 011221          403 LENVVFDEHTREVDYS--------------DK---------SVTENTRAAYPIEYIPNAK--IPCVGPHPKNVILLA-CD  456 (490)
Q Consensus       403 lENV~lD~~~~~vdf~--------------d~---------s~T~NtRa~yPi~~i~N~~--~~~~~g~P~~IIfLt-~D  456 (490)
                      +-||.+++++ .|-+.              +.         .-+.|+|.+.|+...||+.  .+...|.|++.|++. +|
T Consensus       323 FTNVa~t~dG-~vwWeG~~~~~p~~~~dw~G~~W~~~~~~paaHPNsRft~pa~qcp~i~p~wedp~GVpIsaiiFGGRr  401 (586)
T PF00821_consen  323 FTNVALTDDG-DVWWEGMDEEPPEHLIDWQGEPWTPESGEPAAHPNSRFTAPASQCPNIDPEWEDPKGVPISAIIFGGRR  401 (586)
T ss_dssp             EES-EEETTS--EE-TT-SS---T-EE-TTSSEE-TTSSS-SS-TT-EEEEEGGGSTTB-TTTT-TT-EEEEEEEEEEBB
T ss_pred             EeeeeecCCC-ceeeccCCCCCCcccccCCCCcCCCCCCCCCCCCcccccCCHhHCCCCCccccCCCcceEEEEEEeccC
Confidence            9999999864 66333              22         5679999999999999985  345678899777766 66


Q ss_pred             cCCCCCCcc-ccCHHHHHH
Q 011221          457 AFGVLPPVS-KLNLAQTMY  474 (490)
Q Consensus       457 afgvLPPVs-kLt~eQA~y  474 (490)
                       ...+|+|. -++-+...+
T Consensus       402 -~~tvPlV~ea~~W~HGV~  419 (586)
T PF00821_consen  402 -SDTVPLVYEAFNWQHGVF  419 (586)
T ss_dssp             -SSSS-SEEE-SSHHHHHH
T ss_pred             -CCCCCceEEccCCCceeE
Confidence             45678887 456766655


No 12 
>COG1274 PckA Phosphoenolpyruvate carboxykinase (GTP) [Energy production and conversion]
Probab=99.72  E-value=1.3e-16  Score=168.28  Aligned_cols=324  Identities=18%  Similarity=0.199  Sum_probs=219.1

Q ss_pred             ccceeEE-cCCHHH---HHHHHHhhcCCeEEe---cCCceEEecC-CeecCCCCCeeeecCC--CccccccccC---cCc
Q 011221          140 KFTHVLY-NLSPAE---LYEQAIKYEQGSFIA---SSGALATLSG-AKTGRSPRDKRVVKDE--TTEHELWWGK---MKN  206 (490)
Q Consensus       140 ~~~~v~~-Nls~~e---L~e~A~~~~~g~~~t---~~GaL~~~tG-~~TGRSpkdk~iV~~~--~t~~~i~wg~---~~e  206 (490)
                      .+..|+. .=|.+|   |.+++++.++-..+-   .-+..++.|. .=..|.-..+||.-..  ..-....|-.   |.+
T Consensus        32 ~P~~V~~cdGS~eE~~~l~~~~v~aG~~i~Ln~~~~pn~~l~~s~psDvAR~e~rTfI~s~~~~~agPtnNw~~p~e~~~  111 (608)
T COG1274          32 EPDDVVVCDGSPEEYDYLCWKMVEAGEEIKLNPEKHPNSYLARSNPSDVARVEERTFICSPKEEDAGPTNNWMDPQEMRS  111 (608)
T ss_pred             CCCeEEEeCCCHHHHHHHHHHHHhcCceeecCcccCCCceEeecChhhhhhhhhceeeecccccccCCccCCCCHHHHHH
Confidence            3666665 445544   444455443332222   1133333332 2234555566877643  2222334544   221


Q ss_pred             c----------cccEEEEEeeecC-CCCCeEEEEEEecccchHHHHhhcccCCChHhhccCC-CCCEE--EEEcCCCCCC
Q 011221          207 H----------DVQVFVNDQFLNW-DPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFG-TPDFT--IYNAGQFPCN  272 (490)
Q Consensus       207 ~----------~~~lyv~D~~vG~-d~~~~i~vRvit~~a~~alf~~NLf~rp~~~e~~~~~-~pD~t--I~~ap~f~~~  272 (490)
                      +          -|.|||+--.+|- ++.+.+....+|+++|..+.|+- ..|=-.++++..| ...|+  +.++..-.+.
T Consensus       112 ~m~~l~~G~MrGrtmyVvpf~mGP~~Spf~~~gVeiTDS~YVv~sm~i-mtRmG~~vl~~lG~~g~Fvk~vHSvG~pL~p  190 (608)
T COG1274         112 EMNELFRGCMRGRTMYVVPFCMGPLNSPFTILGVELTDSPYVVHSMRI-MTRMGKEVLEKLGDDGNFVKCVHSVGKPLDP  190 (608)
T ss_pred             HHHHHHHhhhcCceEEEEeeeeCCCCCCcccceeEeecCceeeeehHH-HHHHHHHHHHhcCCCCceeeeeeccCCCCCC
Confidence            1          2899997766665 88999999999999999886654 3444556665553 22354  4444431111


Q ss_pred             ccCCC---CCcccEEEEecCCCeEEEEcccchhh---hHH-HHHHHHHHhcccCCeeeecccc-cc-CCCCCEEEEEe--
Q 011221          273 RYTHY---MTSSTSIDLNLARREMVILGTQYAGE---MKK-GLFSVMHYLMPKRQILSLHSGC-NM-GKDGDVALFFG--  341 (490)
Q Consensus       273 ~~~~g---~~s~~~i~id~~~~~~~I~Gt~Y~GE---mKK-~iltl~~~~l~~~G~L~~H~sa-ni-~~~g~~~lffG--  341 (490)
                      ...+.   .+.--.|.+-++.+.|+..|+.|.|+   .|| -.|+++.++..++|||+.|+-. .+ +.+|+...|.|  
T Consensus       191 g~~dv~wPcn~~k~i~hfped~~v~S~gsgYGGNall~KKC~ALRias~~A~~EGWLAEHMlil~v~~PeGk~~yftaAF  270 (608)
T COG1274         191 GQKDVAWPCNETKYIRHFPEDREVWSFGSGYGGNALLGKKCLALRIASVMARDEGWLAEHMLILGVTNPEGKKYYFTAAF  270 (608)
T ss_pred             CcccCcCCcccccceeecCCCcceEeecCCccchhhhhhhHHHHHHHHHHhhhhhhHhhhheeeEecCCCCceEEEEeec
Confidence            11111   01012233345589999999999998   799 7999999999999999999985 22 36788999999  


Q ss_pred             CCCCCccccccc-C---C--CceeecCceeec--CCCc-c--ccCcceEEeecCCCCCCCcchhhccc-ccceeeeeEEc
Q 011221          342 LSGTGKTTLSTD-H---N--RYLIGDDEHCWG--DNGV-S--NIEGGCYAKCIDLSREKEPDIWNAIK-FGAVLENVVFD  409 (490)
Q Consensus       342 lSGtGKTTLs~~-~---~--~~lI~DD~~~ws--d~Gv-f--n~EgGcYaK~~dLs~e~eP~I~~Ai~-f~ailENV~lD  409 (490)
                      +|+||||.|++- |   +  -.+|+||+.-+-  .||. |  |.|.|+|.-.-+.+....|-+|+.++ -.+|+-||.|.
T Consensus       271 PSacGKTnlAMi~p~~pGWk~~~igDDIawik~~~DG~lyAvNPE~GfFGVapGtn~~tnpnam~tl~~~n~IFTNV~lT  350 (608)
T COG1274         271 PSACGKTNLAMIPPTIPGWKAETIGDDIAWIKFGKDGRLYAVNPEIGFFGVAPGTNEKTNPNAMATLHSGNTIFTNVALT  350 (608)
T ss_pred             ccccCccchhhcCCCCCCcceeeccCceeeeeccCCCceEeeccccceEEeecCCCccCChhHHHHhccCceEEeeeeec
Confidence            999999999993 3   2  358999986544  7884 4  99999999999999999999999997 79999999998


Q ss_pred             CCCCeeecCC------------------------CCccccceEEEecccccCCC--CCCCCCCccEEEEEEeecCCCCCC
Q 011221          410 EHTREVDYSD------------------------KSVTENTRAAYPIEYIPNAK--IPCVGPHPKNVILLACDAFGVLPP  463 (490)
Q Consensus       410 ~~~~~vdf~d------------------------~s~T~NtRa~yPi~~i~N~~--~~~~~g~P~~IIfLt~DafgvLPP  463 (490)
                      ++ +.|-+..                        ..-+.|+|.+.|++..|++.  -+..-|.|++.|++.-++...+|+
T Consensus       351 ~D-GdvwWEG~~~~~p~~l~dw~G~~w~~~~~g~paAHpNsRft~pl~~~P~ld~ew~dP~GVpi~aiiFGgRr~~TvPl  429 (608)
T COG1274         351 DD-GDVWWEGLEGEPPEELIDWKGNDWRPGETGEPAAHPNSRFTVPLSQCPNLDPEWDDPEGVPIDAIIFGGRRPTTVPL  429 (608)
T ss_pred             CC-CCccccCCCCCCccccccCCCCccCCCCCCCCCCCCCcccccchhhCCccCccccCCCCceEeeEEecCcCCcccCc
Confidence            75 4553321                        14578999999999999984  334558899877777444668888


Q ss_pred             cc
Q 011221          464 VS  465 (490)
Q Consensus       464 Vs  465 (490)
                      |-
T Consensus       430 V~  431 (608)
T COG1274         430 VT  431 (608)
T ss_pred             ee
Confidence            74


No 13 
>KOG3749 consensus Phosphoenolpyruvate carboxykinase [Energy production and conversion]
Probab=99.04  E-value=1.2e-09  Score=115.88  Aligned_cols=240  Identities=23%  Similarity=0.299  Sum_probs=174.4

Q ss_pred             ccEEEEEeeecC--CCCCeEEEEEEecccchHHHHhhcccC--CChHhhccCCCCCEE--EEEc--C---------CCCC
Q 011221          209 VQVFVNDQFLNW--DPQNRVKVRIVSARAYHSLFMHNMCIR--PTPEELENFGTPDFT--IYNA--G---------QFPC  271 (490)
Q Consensus       209 ~~lyv~D~~vG~--d~~~~i~vRvit~~a~~alf~~NLf~r--p~~~e~~~~~~pD~t--I~~a--p---------~f~~  271 (490)
                      |.|||+---+|-  .|...+-+ .+|+++|.-+.||-|+..  |..+.+   +..||+  +...  |         .|++
T Consensus       155 RtMYVvPFSMGpvGsplskiGi-qlTDspyvV~smRimtR~g~~Vl~~l---~~~dFvrClHSVG~Prp~~~~~v~~wpc  230 (640)
T KOG3749|consen  155 RTMYVVPFSMGPVGSPLSKIGI-QLTDSPYVVLSMRIMTRMGTPVLDAL---GDGDFVRCLHSVGMPRPGQQKIVNPWPC  230 (640)
T ss_pred             ceEEEEeeccCCCCCcchhcee-EecCCceeeeehhHHHHhccHHHHHh---cccchhhhhhhcCCCCCcccCCCCCCCC
Confidence            889999877776  55555544 679999999999988865  333433   344553  2111  1         2555


Q ss_pred             CccCCCCCcccEEEEecCCCeEEEEcccchhh---hHHH-HHHHHHHhcccCCeeeeccccccC---CCCCEEE--EEeC
Q 011221          272 NRYTHYMTSSTSIDLNLARREMVILGTQYAGE---MKKG-LFSVMHYLMPKRQILSLHSGCNMG---KDGDVAL--FFGL  342 (490)
Q Consensus       272 ~~~~~g~~s~~~i~id~~~~~~~I~Gt~Y~GE---mKK~-iltl~~~~l~~~G~L~~H~sani~---~~g~~~l--ffGl  342 (490)
                      +|+.      ++|..-+.+++++.-|..|.|+   -||. .|+++..+..++|||..|+-. ++   ..|+...  ..=+
T Consensus       231 nPe~------t~i~hkp~e~EI~s~GsgyGgnsllGkKcFalriaS~iak~eGWLAEhmlI-lgITnP~g~k~~iaaafp  303 (640)
T KOG3749|consen  231 NPER------TLIAHKPDEREIWSFGSGYGGNSLLGKKCFALRIASRLAKDEGWLAEHMLI-LGITNPKGEKKYIAAAFP  303 (640)
T ss_pred             Ccce------eEEeecCccceeeeeccCCCCCccccchhhhhhhhhhhhhhhhhHHHhHHH-hcccCCCCCceEEEEecc
Confidence            5544      7888889999999999999998   3444 566667888999999999984 44   4566433  3338


Q ss_pred             CCCCccccccc----CCCc--eeecCcee--ecCCCc---cccCcceEEeecCCCCCCCcchhhcccccceeeeeEEcCC
Q 011221          343 SGTGKTTLSTD----HNRY--LIGDDEHC--WGDNGV---SNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEH  411 (490)
Q Consensus       343 SGtGKTTLs~~----~~~~--lI~DD~~~--wsd~Gv---fn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailENV~lD~~  411 (490)
                      |.||||.|++.    |+-+  .++||+.-  |+.+|.   +|.|.|+|.-..+-+...-|.-.+.+.-++|++||.=..+
T Consensus       304 SacgktnLam~~p~lPGwKV~cVgddiaWmkf~~dG~l~ainPEngffgvapgts~~tnP~am~t~~~ntIftnvaeTsD  383 (640)
T KOG3749|consen  304 SACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDADGRLRAINPENGFFGVAPGTSEKTNPNAMATIQKNTIFTNVAETSD  383 (640)
T ss_pred             cccccchHhhcCCCCCCceEEEeccceeEEEecCCCeEEEecccccccccCCCcccccCHHHHHHHHhccceeeeeeccC
Confidence            99999999982    3433  69999853  777895   4999999999999999989977777778999999877665


Q ss_pred             CCeeecCC-------------------------CCccccceEEEecccccCCCC--CCCCCCccEEEEEE-eecCCC
Q 011221          412 TREVDYSD-------------------------KSVTENTRAAYPIEYIPNAKI--PCVGPHPKNVILLA-CDAFGV  460 (490)
Q Consensus       412 ~~~vdf~d-------------------------~s~T~NtRa~yPi~~i~N~~~--~~~~g~P~~IIfLt-~Dafgv  460 (490)
                       +.+.+..                         ..-+.|.|.+-|-..-|++..  .+.-|.|+..|++. ++..||
T Consensus       384 -g~~~weg~e~~l~~~v~it~wlgk~w~~~~~~~aahPnsrf~~pa~Qcpii~p~Wesp~GVPI~AiiFggRRp~gv  459 (640)
T KOG3749|consen  384 -GGVYWEGIEKPLAPGVTITSWLGKPWSIGDGEPAAHPNSRFCAPASQCPIIDPAWESPEGVPISAIIFGGRRPAGV  459 (640)
T ss_pred             -CceeeccccccccCCceeecccCCcccCCCCCcCCCCcccccCchhhCCCcCccccCCCCCceeEEEecCCCCCCC
Confidence             3454432                         144589999999999988742  24458899777666 553444


No 14 
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions.  The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.
Probab=97.96  E-value=3.8e-06  Score=78.12  Aligned_cols=45  Identities=27%  Similarity=0.355  Sum_probs=38.8

Q ss_pred             eeeccccccCCCCCEEEEEeCCCCCcccccc---cCCCceeecCceeec
Q 011221          322 LSLHSGCNMGKDGDVALFFGLSGTGKTTLST---DHNRYLIGDDEHCWG  367 (490)
Q Consensus       322 L~~H~sani~~~g~~~lffGlSGtGKTTLs~---~~~~~lI~DD~~~ws  367 (490)
                      ..+||++ +..+|..++|.|+||+|||||+.   ..+..+|+||.....
T Consensus         3 ~~~H~~~-v~~~g~gvLi~G~sG~GKStlal~L~~~g~~lvaDD~v~v~   50 (149)
T cd01918           3 VTVHGVL-VEVGGIGVLITGPSGIGKSELALELIKRGHRLVADDRVVVK   50 (149)
T ss_pred             ccEEEEE-EEECCEEEEEEcCCCCCHHHHHHHHHHcCCeEEECCEEEEE
Confidence            5789998 88889999999999999999887   456789999987655


No 15 
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=97.70  E-value=8.9e-06  Score=71.90  Aligned_cols=50  Identities=30%  Similarity=0.255  Sum_probs=36.7

Q ss_pred             CeeeeccccccCCCCCEEEEEeCCCCCccccccc-CC--CceeecCceeecCC
Q 011221          320 QILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTD-HN--RYLIGDDEHCWGDN  369 (490)
Q Consensus       320 G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~~-~~--~~lI~DD~~~wsd~  369 (490)
                      |++.+|+.+-.-..|+.++|.|+||+|||||... +.  -.+.+||...++++
T Consensus         1 ~~~aL~~vsl~i~~ge~v~I~GpSGsGKSTLl~~l~~G~i~~~g~di~~~~~~   53 (107)
T cd00820           1 GTTSLHGVLVDVYGKVGVLITGDSGIGKTELALELIKRKHRLVGDDNVEIRED   53 (107)
T ss_pred             CceEEEeeEEEEcCCEEEEEEcCCCCCHHHHHHHhhCCeEEEeeEeHHHhhhh
Confidence            5788999862236688999999999999997762 22  23667877766643


No 16 
>PF07475 Hpr_kinase_C:  HPr Serine kinase C-terminal domain;  InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents the C-terminal kinase domain of Hpr Serine/threonine kinase PtsK. This kinase is the sensor in a multicomponent phosphorelay system in control of carbon catabolic repression in bacteria []. This kinase in unusual in that it recognises the tertiary structure of its target and is a member of a novel family unrelated to any previously described protein phosphorylating enzymes []. X-ray analysis of the full-length crystalline enzyme from Staphylococcus xylosus at a resolution of 1.95 A shows the enzyme to consist of two clearly separated domains that are assembled in a hexameric structure resembling a three-bladed propeller [].; GO: 0000155 two-component sensor activity, 0004672 protein kinase activity, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay), 0006109 regulation of carbohydrate metabolic process; PDB: 2QMH_C 1KKM_B 1KKL_C 1JB1_A 3TQF_B 1KNX_B 1KO7_A.
Probab=97.66  E-value=2.3e-05  Score=74.65  Aligned_cols=46  Identities=28%  Similarity=0.346  Sum_probs=39.6

Q ss_pred             eeeeccccccCCCCCEEEEEeCCCCCcccccc---cCCCceeecCceeec
Q 011221          321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLST---DHNRYLIGDDEHCWG  367 (490)
Q Consensus       321 ~L~~H~sani~~~g~~~lffGlSGtGKTTLs~---~~~~~lI~DD~~~ws  367 (490)
                      ...+||++ +..+|..++|.|.||+|||||+.   ..++.||+||.+.+.
T Consensus         6 ~~~~Hg~~-v~i~G~GVLi~G~SG~GKS~lAl~Li~rGh~lvaDD~v~i~   54 (171)
T PF07475_consen    6 RTTLHGSL-VDIGGVGVLITGPSGIGKSELALELIKRGHRLVADDRVEIR   54 (171)
T ss_dssp             EEEEESEE-EEETTEEEEEEESTTSSHHHHHHHHHHTT-EEEESSEEEEE
T ss_pred             cceeeEEE-EEECCEEEEEECCCCCCHHHHHHHHHHCCCeEEeCCEEEEE
Confidence            35799998 88999999999999999999877   468899999987755


No 17 
>TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene of Enterococcus faecalis encodes a bifunctional enzyme: the HPr kinase/phosphatase
Probab=97.51  E-value=5.2e-05  Score=77.95  Aligned_cols=73  Identities=23%  Similarity=0.231  Sum_probs=52.3

Q ss_pred             eEEEEcccchhhhHHHHHHHHHHhcc-cCCeeeeccccccCCCCCEEEEEeCCCCCcccccc---cCCCceeecCceeec
Q 011221          292 EMVILGTQYAGEMKKGLFSVMHYLMP-KRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST---DHNRYLIGDDEHCWG  367 (490)
Q Consensus       292 ~~~I~Gt~Y~GEmKK~iltl~~~~l~-~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~---~~~~~lI~DD~~~ws  367 (490)
                      .+-++-+.+.+-  ..+..+..|+-. -.+..++||++ +...|..++|.|.||+|||||+.   ..++.||+||.+...
T Consensus       106 ~ip~l~t~~~~~--~~~~~l~~~L~~~la~~~~~hg~~-v~i~g~gvli~G~sg~GKS~lal~Li~rg~~lvaDD~~~~~  182 (304)
T TIGR00679       106 QVPILKTDLFST--ELSFRLETYLNEQFAPTAAIHGVL-VEVYGVGVLITGKSGVGKSETALELINRGHRLVADDAVEIY  182 (304)
T ss_pred             CCcEEEeCCcHH--HHHHHHHHHHHHhhccceeeeeEE-EEECCEEEEEEcCCCCCHHHHHHHHHHcCCceeecCeEEEE
Confidence            344455555551  122223343333 47778999998 88999999999999999999777   568899999987654


No 18 
>PRK05428 HPr kinase/phosphorylase; Provisional
Probab=97.29  E-value=0.00014  Score=75.10  Aligned_cols=46  Identities=26%  Similarity=0.234  Sum_probs=40.2

Q ss_pred             eeeeccccccCCCCCEEEEEeCCCCCcccccc---cCCCceeecCceeec
Q 011221          321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLST---DHNRYLIGDDEHCWG  367 (490)
Q Consensus       321 ~L~~H~sani~~~g~~~lffGlSGtGKTTLs~---~~~~~lI~DD~~~ws  367 (490)
                      ...+||.+ +...|..++|.|.||+|||+|+.   ..++.||+||.+.+.
T Consensus       134 ~~~iHg~~-v~V~G~GvLi~G~SG~GKSelALeLi~rGh~LVaDD~v~i~  182 (308)
T PRK05428        134 RTSVHGVL-VDIYGIGVLITGESGIGKSETALELIKRGHRLVADDAVDIK  182 (308)
T ss_pred             cceeeeEE-EEECCEEEEEEcCCCCCHHHHHHHHHHcCCceEecCeEEEE
Confidence            45789998 88999999999999999999877   568899999997655


No 19 
>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms]
Probab=97.25  E-value=0.00018  Score=73.75  Aligned_cols=74  Identities=23%  Similarity=0.284  Sum_probs=50.8

Q ss_pred             eEEEEcccchhhhHHHHHHHHHHhcc-cCCeeeeccccccCCCCCEEEEEeCCCCCcccccc---cCCCceeecCceeec
Q 011221          292 EMVILGTQYAGEMKKGLFSVMHYLMP-KRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST---DHNRYLIGDDEHCWG  367 (490)
Q Consensus       292 ~~~I~Gt~Y~GEmKK~iltl~~~~l~-~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~---~~~~~lI~DD~~~ws  367 (490)
                      .+-|+-+.++..  --.+++.+|+.. .--...+||.+ +...|-.+++.|+||+|||+|+-   +.+++||+||.+.+.
T Consensus       105 ~~pil~s~~~ts--~l~~~l~~yL~~~lA~~~~vHGvl-~~I~GvGVLItG~SG~GKSElALeLi~rghrLVaDD~V~i~  181 (308)
T COG1493         105 NIPILTSKLSTS--ELSFTLTNYLSRPLAERVNVHGVL-LDIFGVGVLITGPSGAGKSELALELIKRGHRLVADDAVEIF  181 (308)
T ss_pred             CCceEEecchHH--HHHHHHHHHhhhhcccceeeeeEE-EEEeeeEEEEECCCCCCHhHHHHHHHHhccceeccccEEEE
Confidence            344444444432  123444555444 22346789987 77888889999999999998766   578999999998766


Q ss_pred             C
Q 011221          368 D  368 (490)
Q Consensus       368 d  368 (490)
                      -
T Consensus       182 ~  182 (308)
T COG1493         182 R  182 (308)
T ss_pred             e
Confidence            3


No 20 
>PRK06217 hypothetical protein; Validated
Probab=95.30  E-value=0.011  Score=55.40  Aligned_cols=35  Identities=26%  Similarity=0.345  Sum_probs=26.9

Q ss_pred             EEEEEeCCCCCcccccc----cCCCceeecCceeecCCC
Q 011221          336 VALFFGLSGTGKTTLST----DHNRYLIGDDEHCWGDNG  370 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~----~~~~~lI~DD~~~wsd~G  370 (490)
                      .++|+|.||+|||||+.    ..+-..|.-|...|...+
T Consensus         3 ~I~i~G~~GsGKSTla~~L~~~l~~~~~~~D~~~~~~~~   41 (183)
T PRK06217          3 RIHITGASGSGTTTLGAALAERLDIPHLDTDDYFWLPTD   41 (183)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHcCCcEEEcCceeeccCC
Confidence            48999999999999887    235557877777776544


No 21 
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=94.98  E-value=0.011  Score=50.57  Aligned_cols=17  Identities=41%  Similarity=0.694  Sum_probs=15.6

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      ++++.|+|||||||++.
T Consensus         1 vI~I~G~~gsGKST~a~   17 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLAK   17 (121)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            47899999999999887


No 22 
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=94.66  E-value=0.019  Score=46.40  Aligned_cols=21  Identities=48%  Similarity=0.735  Sum_probs=17.7

Q ss_pred             CCCCCEEEEEeCCCCCccccc
Q 011221          331 GKDGDVALFFGLSGTGKTTLS  351 (490)
Q Consensus       331 ~~~g~~~lffGlSGtGKTTLs  351 (490)
                      ...|+..+|.|++|+|||||.
T Consensus        20 ~~~g~~tli~G~nGsGKSTll   40 (62)
T PF13555_consen   20 DPRGDVTLITGPNGSGKSTLL   40 (62)
T ss_pred             cCCCcEEEEECCCCCCHHHHH
Confidence            345779999999999999953


No 23 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=94.64  E-value=0.016  Score=48.11  Aligned_cols=19  Identities=53%  Similarity=0.868  Sum_probs=16.8

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      +..++|+|++||||||++.
T Consensus         2 ~~~~~l~G~~G~GKTtl~~   20 (148)
T smart00382        2 GEVILIVGPPGSGKTTLAR   20 (148)
T ss_pred             CCEEEEECCCCCcHHHHHH
Confidence            4679999999999999776


No 24 
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=94.48  E-value=0.032  Score=56.15  Aligned_cols=21  Identities=43%  Similarity=0.786  Sum_probs=19.4

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|.+.++|||.|||||||+.
T Consensus        28 ~~GEvhaiMGPNGsGKSTLa~   48 (251)
T COG0396          28 KEGEVHAIMGPNGSGKSTLAY   48 (251)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999998


No 25 
>PRK07261 topology modulation protein; Provisional
Probab=94.47  E-value=0.023  Score=53.07  Aligned_cols=32  Identities=28%  Similarity=0.354  Sum_probs=22.4

Q ss_pred             EEEEEeCCCCCccccccc----CCCceeecCceeec
Q 011221          336 VALFFGLSGTGKTTLSTD----HNRYLIGDDEHCWG  367 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~~----~~~~lI~DD~~~ws  367 (490)
                      .++++|.||+|||||+..    .+-.+|.-|...|.
T Consensus         2 ri~i~G~~GsGKSTla~~l~~~~~~~~i~~D~~~~~   37 (171)
T PRK07261          2 KIAIIGYSGSGKSTLARKLSQHYNCPVLHLDTLHFQ   37 (171)
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHhCCCeEecCCEEec
Confidence            478999999999999872    23345554555554


No 26 
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=94.42  E-value=0.018  Score=50.44  Aligned_cols=17  Identities=35%  Similarity=0.722  Sum_probs=15.5

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      ++++.|++||||||++.
T Consensus         1 lii~~G~pgsGKSt~a~   17 (143)
T PF13671_consen    1 LIILCGPPGSGKSTLAK   17 (143)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            47999999999999877


No 27 
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=94.27  E-value=0.046  Score=56.66  Aligned_cols=32  Identities=31%  Similarity=0.484  Sum_probs=23.0

Q ss_pred             CCeeeeccccccCCCC-CEEEEEeCCCCCcccccc
Q 011221          319 RQILSLHSGCNMGKDG-DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       319 ~G~L~~H~sani~~~g-~~~lffGlSGtGKTTLs~  352 (490)
                      -|-+.+  -+|....| .+.++||+||+|||||.+
T Consensus        10 lG~~~l--~a~~~~p~~GvTAlFG~SGsGKTslin   42 (352)
T COG4148          10 LGNFAL--DANFTLPARGITALFGPSGSGKTSLIN   42 (352)
T ss_pred             cCceEE--EEeccCCCCceEEEecCCCCChhhHHH
Confidence            344444  34555445 689999999999999776


No 28 
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=94.25  E-value=0.023  Score=56.58  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.++++|+||||||||.+
T Consensus        29 ~~Ge~vaI~GpSGSGKSTLLn   49 (226)
T COG1136          29 EAGEFVAIVGPSGSGKSTLLN   49 (226)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999776


No 29 
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism]
Probab=94.18  E-value=0.026  Score=54.04  Aligned_cols=36  Identities=39%  Similarity=0.582  Sum_probs=26.0

Q ss_pred             cCCCCCEEEEEeCCCCCcccccc----cCCCcee-ecCcee
Q 011221          330 MGKDGDVALFFGLSGTGKTTLST----DHNRYLI-GDDEHC  365 (490)
Q Consensus       330 i~~~g~~~lffGlSGtGKTTLs~----~~~~~lI-~DD~~~  365 (490)
                      ++.-.++++++|.|||||||...    .-+...| +||.|-
T Consensus         8 ~~~~k~~i~vmGvsGsGKSTigk~L~~~l~~~F~dgDd~Hp   48 (191)
T KOG3354|consen    8 MGPFKYVIVVMGVSGSGKSTIGKALSEELGLKFIDGDDLHP   48 (191)
T ss_pred             cCCCceeEEEEecCCCChhhHHHHHHHHhCCcccccccCCC
Confidence            34456799999999999999765    2244444 788774


No 30 
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]
Probab=94.16  E-value=0.021  Score=55.41  Aligned_cols=21  Identities=48%  Similarity=0.858  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.+.++-|.||||+|||||+.
T Consensus        21 ~~~~viW~TGLSGsGKSTiA~   41 (197)
T COG0529          21 QKGAVIWFTGLSGSGKSTIAN   41 (197)
T ss_pred             CCCeEEEeecCCCCCHHHHHH
Confidence            456789999999999999988


No 31 
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=94.11  E-value=0.014  Score=66.93  Aligned_cols=87  Identities=32%  Similarity=0.537  Sum_probs=51.1

Q ss_pred             EEEEEeCCCCCcccccccCCCceeecCceeec-C-----------------CCccccC-cce---------E-Ee-ecCC
Q 011221          336 VALFFGLSGTGKTTLSTDHNRYLIGDDEHCWG-D-----------------NGVSNIE-GGC---------Y-AK-CIDL  385 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~~~~~~lI~DD~~~ws-d-----------------~Gvfn~E-gGc---------Y-aK-~~dL  385 (490)
                      +.+|.||||.|||.|+-.-...|-+|+...+. |                 -|.-++| ||.         | +- .|.+
T Consensus       523 sFlF~GPTGVGKTELAkaLA~~Lfg~e~aliR~DMSEy~EkHsVSrLIGaPPGYVGyeeGG~LTEaVRr~PySViLlDEI  602 (786)
T COG0542         523 SFLFLGPTGVGKTELAKALAEALFGDEQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEI  602 (786)
T ss_pred             EEEeeCCCcccHHHHHHHHHHHhcCCCccceeechHHHHHHHHHHHHhCCCCCCceeccccchhHhhhcCCCeEEEechh
Confidence            69999999999999876322222222222111 2                 2322443 333         3 22 2323


Q ss_pred             CCCCCcchhhcccccceeee-eEEcCCCCeeecCCCC--cccc
Q 011221          386 SREKEPDIWNAIKFGAVLEN-VVFDEHTREVDYSDKS--VTEN  425 (490)
Q Consensus       386 s~e~eP~I~~Ai~f~ailEN-V~lD~~~~~vdf~d~s--~T~N  425 (490)
                       +...|+|+|-  |-.|+++ ..-|..|+.|||.|..  .|.|
T Consensus       603 -EKAHpdV~ni--lLQVlDdGrLTD~~Gr~VdFrNtiIImTSN  642 (786)
T COG0542         603 -EKAHPDVFNL--LLQVLDDGRLTDGQGRTVDFRNTIIIMTSN  642 (786)
T ss_pred             -hhcCHHHHHH--HHHHhcCCeeecCCCCEEecceeEEEEecc
Confidence             4578999987  4345444 6778889999998773  3455


No 32 
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=94.05  E-value=0.025  Score=59.27  Aligned_cols=21  Identities=43%  Similarity=0.782  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+|.-++|.|+||||||||..
T Consensus        27 ~~Gef~vllGPSGcGKSTlLr   47 (338)
T COG3839          27 EDGEFVVLLGPSGCGKSTLLR   47 (338)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999665


No 33 
>PRK08118 topology modulation protein; Reviewed
Probab=94.04  E-value=0.025  Score=52.87  Aligned_cols=32  Identities=28%  Similarity=0.434  Sum_probs=22.9

Q ss_pred             EEEEEeCCCCCccccccc----CCCceeecCceeec
Q 011221          336 VALFFGLSGTGKTTLSTD----HNRYLIGDDEHCWG  367 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~~----~~~~lI~DD~~~ws  367 (490)
                      .++++|++|+|||||+..    .+-.++.=|...|.
T Consensus         3 rI~I~G~~GsGKSTlak~L~~~l~~~~~~lD~l~~~   38 (167)
T PRK08118          3 KIILIGSGGSGKSTLARQLGEKLNIPVHHLDALFWK   38 (167)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhCCCceecchhhcc
Confidence            589999999999998872    24445654555554


No 34 
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=94.03  E-value=0.012  Score=59.24  Aligned_cols=136  Identities=27%  Similarity=0.316  Sum_probs=81.0

Q ss_pred             CEEEEEeCCCCCccccccc-------CCCceee---cCceeecC--CCccccCcceEEeecCCCCCCCcchhhcccccce
Q 011221          335 DVALFFGLSGTGKTTLSTD-------HNRYLIG---DDEHCWGD--NGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAV  402 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~~-------~~~~lI~---DD~~~wsd--~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ai  402 (490)
                      ..++++|..|||||+|...       .+=+||-   +|+..+.+  +-+-+..-=+-.=||||+=+..-.-|++++  ++
T Consensus        53 nnvLL~G~rGtGKSSlVkall~~y~~~GLRlIev~k~~L~~l~~l~~~l~~~~~kFIlf~DDLsFe~~d~~yk~LK--s~  130 (249)
T PF05673_consen   53 NNVLLWGARGTGKSSLVKALLNEYADQGLRLIEVSKEDLGDLPELLDLLRDRPYKFILFCDDLSFEEGDTEYKALK--SV  130 (249)
T ss_pred             cceEEecCCCCCHHHHHHHHHHHHhhcCceEEEECHHHhccHHHHHHHHhcCCCCEEEEecCCCCCCCcHHHHHHH--HH
Confidence            4689999999999997651       1223432   22222110  001122333556689999665555677754  66


Q ss_pred             eeeeEEcCCCCeeecCCCCccccceEEEecccccCCCCCCCCCCccEEEE--EE-eecCCCCCCccccCHHHHHHHHHh
Q 011221          403 LENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVIL--LA-CDAFGVLPPVSKLNLAQTMYHFIS  478 (490)
Q Consensus       403 lENV~lD~~~~~vdf~d~s~T~NtRa~yPi~~i~N~~~~~~~g~P~~IIf--Lt-~DafgvLPPVskLt~eQA~y~Fls  478 (490)
                      ||.-....-...+.|    -|.|-|-.+|-.+.+|.....-.-||.+.+=  ++ .|+||..  |....+.|..|.=+-
T Consensus       131 LeGgle~~P~Nvliy----ATSNRRHLv~E~~~d~~~~~~~eih~~d~~eEklSLsDRFGL~--l~F~~~~q~~YL~IV  203 (249)
T PF05673_consen  131 LEGGLEARPDNVLIY----ATSNRRHLVPESFSDREDIQDDEIHPSDTIEEKLSLSDRFGLW--LSFYPPDQEEYLAIV  203 (249)
T ss_pred             hcCccccCCCcEEEE----EecchhhccchhhhhccCCCccccCcchHHHHHHhHHHhCCcE--EEecCCCHHHHHHHH
Confidence            666332221223333    3579999999999888642222345665554  33 7999997  777778888776443


No 35 
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=94.00  E-value=0.028  Score=56.19  Aligned_cols=21  Identities=43%  Similarity=0.768  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.++++.|+||+|||||..
T Consensus        26 ~~Gevv~iiGpSGSGKSTlLR   46 (240)
T COG1126          26 EKGEVVVIIGPSGSGKSTLLR   46 (240)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 36 
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=93.96  E-value=0.048  Score=52.71  Aligned_cols=47  Identities=21%  Similarity=0.317  Sum_probs=31.7

Q ss_pred             hhHHHHHHHHHHhcccCCeeeeccccccC-CCCCEEEEEeCCCCCcccccc
Q 011221          303 EMKKGLFSVMHYLMPKRQILSLHSGCNMG-KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       303 EmKK~iltl~~~~l~~~G~L~~H~sani~-~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +||+  +.+.+.-....+...+|.- ++. ..|..+++.|++|+|||||..
T Consensus        19 ~~~~--l~~~~~~~~~~~~~il~~v-s~~i~~Ge~~~i~G~nGsGKSTLl~   66 (224)
T cd03220          19 SLKK--LGILGRKGEVGEFWALKDV-SFEVPRGERIGLIGRNGAGKSTLLR   66 (224)
T ss_pred             hhhh--hhhhhhhhhcCCeEEEeee-EEEEcCCCEEEEECCCCCCHHHHHH
Confidence            4677  5555554444444445432 233 578999999999999999766


No 37 
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=93.77  E-value=0.026  Score=51.25  Aligned_cols=27  Identities=26%  Similarity=0.594  Sum_probs=19.0

Q ss_pred             EEEEeCCCCCccccccc----CCCceeecCc
Q 011221          337 ALFFGLSGTGKTTLSTD----HNRYLIGDDE  363 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~~----~~~~lI~DD~  363 (490)
                      +++.|++||||||++..    .+..+|..|.
T Consensus         1 i~l~G~~GsGKSTla~~l~~~l~~~~v~~D~   31 (163)
T TIGR01313         1 FVLMGVAGSGKSTIASALAHRLGAKFIEGDD   31 (163)
T ss_pred             CEEECCCCCCHHHHHHHHHHhcCCeEEeCcc
Confidence            47899999999998872    2344555443


No 38 
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]
Probab=93.69  E-value=0.015  Score=65.91  Aligned_cols=66  Identities=29%  Similarity=0.514  Sum_probs=43.9

Q ss_pred             CCEEEEEeCCCCCcccccc------cC-CCceeecCceeecCCCccccCcceEEeecCCCCCCCcchhhcccccceeeee
Q 011221          334 GDVALFFGLSGTGKTTLST------DH-NRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENV  406 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~------~~-~~~lI~DD~~~wsd~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailENV  406 (490)
                      |.++++.||||.||||++.      +| .++++-|..-+      -+++.=.|-+-+++= .+||.+|.    ++|.||+
T Consensus       494 Ge~vALVGPSGsGKSTiasLL~rfY~PtsG~IllDG~~i------~~~~~~~lr~~Ig~V-~QEPvLFs----~sI~eNI  562 (716)
T KOG0058|consen  494 GEVVALVGPSGSGKSTIASLLLRFYDPTSGRILLDGVPI------SDINHKYLRRKIGLV-GQEPVLFS----GSIRENI  562 (716)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHhcCCCCCeEEECCeeh------hhcCHHHHHHHeeee-eccceeec----ccHHHHH
Confidence            7899999999999999877      55 45555553322      234444455555553 46887774    4788887


Q ss_pred             EEcC
Q 011221          407 VFDE  410 (490)
Q Consensus       407 ~lD~  410 (490)
                      .+--
T Consensus       563 ~YG~  566 (716)
T KOG0058|consen  563 AYGL  566 (716)
T ss_pred             hcCC
Confidence            7744


No 39 
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=93.68  E-value=0.032  Score=53.51  Aligned_cols=21  Identities=38%  Similarity=0.710  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+-+||+||||||||..
T Consensus        26 a~GeivtlMGPSGcGKSTLls   46 (213)
T COG4136          26 AKGEIVTLMGPSGCGKSTLLS   46 (213)
T ss_pred             cCCcEEEEECCCCccHHHHHH
Confidence            568999999999999999655


No 40 
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=93.59  E-value=0.021  Score=58.45  Aligned_cols=56  Identities=25%  Similarity=0.299  Sum_probs=35.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc------cC-CCceeecCceeecCCCcc-ccCcceEEeecCCCC
Q 011221          332 KDGDVALFFGLSGTGKTTLST------DH-NRYLIGDDEHCWGDNGVS-NIEGGCYAKCIDLSR  387 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~------~~-~~~lI~DD~~~wsd~Gvf-n~EgGcYaK~~dLs~  387 (490)
                      .+|.-++|.|+|||||||+..      .| .+.+.-|++-+-+.+.+. .--.|+-+.-++|=|
T Consensus        25 ~~gef~vliGpSGsGKTTtLkMINrLiept~G~I~i~g~~i~~~d~~~LRr~IGYviQqigLFP   88 (309)
T COG1125          25 EEGEFLVLIGPSGSGKTTTLKMINRLIEPTSGEILIDGEDISDLDPVELRRKIGYVIQQIGLFP   88 (309)
T ss_pred             cCCeEEEEECCCCCcHHHHHHHHhcccCCCCceEEECCeecccCCHHHHHHhhhhhhhhcccCC
Confidence            568889999999999999655      22 334444555554445543 445666666666543


No 41 
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=93.53  E-value=0.033  Score=52.52  Aligned_cols=20  Identities=30%  Similarity=0.760  Sum_probs=17.7

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .|..++++|+||||||||+.
T Consensus         2 ~ge~i~l~G~sGsGKSTl~~   21 (176)
T PRK09825          2 AGESYILMGVSGSGKSLIGS   21 (176)
T ss_pred             CCcEEEEECCCCCCHHHHHH
Confidence            36789999999999999776


No 42 
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=93.46  E-value=0.035  Score=51.03  Aligned_cols=19  Identities=42%  Similarity=0.590  Sum_probs=16.9

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      |..++|.|+||+|||||+.
T Consensus         1 g~ii~l~G~~GsGKsTl~~   19 (180)
T TIGR03263         1 GLLIVISGPSGVGKSTLVK   19 (180)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            5679999999999999776


No 43 
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]
Probab=93.45  E-value=0.031  Score=58.62  Aligned_cols=21  Identities=43%  Similarity=0.887  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+|...++|||||+|||||..
T Consensus        52 ~~GeIfViMGLSGSGKSTLvR   72 (386)
T COG4175          52 EEGEIFVIMGLSGSGKSTLVR   72 (386)
T ss_pred             cCCeEEEEEecCCCCHHHHHH
Confidence            568899999999999999876


No 44 
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=93.44  E-value=0.039  Score=55.66  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.-+.+.|+||||||||..
T Consensus        27 ~~GEfvsilGpSGcGKSTLLr   47 (248)
T COG1116          27 EKGEFVAILGPSGCGKSTLLR   47 (248)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 45 
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=93.43  E-value=0.038  Score=55.31  Aligned_cols=21  Identities=38%  Similarity=0.551  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..+.+++|.||||||||||..
T Consensus        31 ~~~~VTAlIGPSGcGKST~LR   51 (253)
T COG1117          31 PKNKVTALIGPSGCGKSTLLR   51 (253)
T ss_pred             cCCceEEEECCCCcCHHHHHH
Confidence            557899999999999999665


No 46 
>PRK00300 gmk guanylate kinase; Provisional
Probab=93.42  E-value=0.039  Score=51.88  Aligned_cols=21  Identities=38%  Similarity=0.597  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..++|.|+||+|||||+.
T Consensus         3 ~~g~~i~i~G~sGsGKstl~~   23 (205)
T PRK00300          3 RRGLLIVLSGPSGAGKSTLVK   23 (205)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            357889999999999999876


No 47 
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=93.31  E-value=0.037  Score=50.99  Aligned_cols=19  Identities=42%  Similarity=0.621  Sum_probs=16.6

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      |..+++.|+||+|||||+.
T Consensus         1 ~~~~~i~G~sGsGKttl~~   19 (179)
T TIGR02322         1 GRLIYVVGPSGAGKDTLLD   19 (179)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            4578999999999999875


No 48 
>PRK08233 hypothetical protein; Provisional
Probab=93.19  E-value=0.042  Score=50.13  Aligned_cols=19  Identities=37%  Similarity=0.515  Sum_probs=16.7

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      +..++|.|.||+|||||+.
T Consensus         3 ~~iI~I~G~~GsGKtTla~   21 (182)
T PRK08233          3 TKIITIAAVSGGGKTTLTE   21 (182)
T ss_pred             ceEEEEECCCCCCHHHHHH
Confidence            3578999999999999887


No 49 
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=93.15  E-value=0.037  Score=52.74  Aligned_cols=21  Identities=38%  Similarity=0.420  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+.|.|+||+|||||+.
T Consensus         4 ~~g~vi~I~G~sGsGKSTl~~   24 (207)
T TIGR00235         4 PKGIIIGIGGGSGSGKTTVAR   24 (207)
T ss_pred             CCeEEEEEECCCCCCHHHHHH
Confidence            457789999999999999887


No 50 
>PF01583 APS_kinase:  Adenylylsulphate kinase;  InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This domain contains an ATP binding P-loop motif [].; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity, transferring phosphorus-containing groups, 0000103 sulfate assimilation; PDB: 1M7H_B 1M7G_B 3CR7_B 1D6J_A 2OFW_G 1X6V_B 1XNJ_A 1XJQ_B 2PEY_A 2PEZ_B ....
Probab=93.14  E-value=0.036  Score=52.17  Aligned_cols=19  Identities=58%  Similarity=0.779  Sum_probs=16.8

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      |-++.|.|+||+|||||+.
T Consensus         2 g~vIwltGlsGsGKtTlA~   20 (156)
T PF01583_consen    2 GFVIWLTGLSGSGKTTLAR   20 (156)
T ss_dssp             -EEEEEESSTTSSHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHH
Confidence            4579999999999999988


No 51 
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=93.13  E-value=0.042  Score=50.94  Aligned_cols=19  Identities=26%  Similarity=0.566  Sum_probs=17.4

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      |..+++.|+||+||||++.
T Consensus         2 ~~~i~l~G~~gsGKst~a~   20 (175)
T cd00227           2 GRIIILNGGSSAGKSSIAR   20 (175)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            5689999999999999887


No 52 
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]
Probab=92.99  E-value=0.06  Score=52.98  Aligned_cols=32  Identities=28%  Similarity=0.416  Sum_probs=23.6

Q ss_pred             CeeeeccccccCCCCCEEEEEeCCCCCcccccc
Q 011221          320 QILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       320 G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +-++|+=.+ -...|+.+++.|+||+|||||.+
T Consensus        12 ~~~~~~fdl-~v~~ge~vAi~GpSGaGKSTLLn   43 (231)
T COG3840          12 GHLPMRFDL-TVPAGEIVAILGPSGAGKSTLLN   43 (231)
T ss_pred             CcceEEEEE-eecCCcEEEEECCCCccHHHHHH
Confidence            445554443 22568899999999999999766


No 53 
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=92.98  E-value=0.044  Score=46.62  Aligned_cols=16  Identities=38%  Similarity=0.619  Sum_probs=14.8

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      +++.|.+|+||||++.
T Consensus         1 I~i~G~~GsGKtTia~   16 (129)
T PF13238_consen    1 IGISGIPGSGKTTIAK   16 (129)
T ss_dssp             EEEEESTTSSHHHHHH
T ss_pred             CEEECCCCCCHHHHHH
Confidence            6899999999999887


No 54 
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=92.91  E-value=0.038  Score=53.93  Aligned_cols=41  Identities=32%  Similarity=0.511  Sum_probs=32.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc------cC-CC--ceeecCceeecCCCcc
Q 011221          332 KDGDVALFFGLSGTGKTTLST------DH-NR--YLIGDDEHCWGDNGVS  372 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~------~~-~~--~lI~DD~~~wsd~Gvf  372 (490)
                      +.|.++.+.|+||+|||||.+      ++ ++  +|.+.+.+-.++++.-
T Consensus        34 ~~Ge~vaiVG~SGSGKSTLl~vlAGLd~~ssGeV~l~G~~L~~ldEd~rA   83 (228)
T COG4181          34 KRGETVAIVGPSGSGKSTLLAVLAGLDDPSSGEVRLLGQPLHKLDEDARA   83 (228)
T ss_pred             cCCceEEEEcCCCCcHHhHHHHHhcCCCCCCceEEEcCcchhhcCHHHHH
Confidence            568999999999999999776      22 12  4778899999988864


No 55 
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=92.79  E-value=0.018  Score=62.93  Aligned_cols=21  Identities=38%  Similarity=0.550  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|.||+|||||..
T Consensus       374 ~~G~~vaIvG~SGsGKSTL~~  394 (588)
T PRK11174        374 PAGQRIALVGPSGAGKTSLLN  394 (588)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999876


No 56 
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=92.75  E-value=0.054  Score=50.80  Aligned_cols=19  Identities=37%  Similarity=0.691  Sum_probs=16.8

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      |..++|.|+||+|||||..
T Consensus         2 g~~i~l~G~sGsGKsTl~~   20 (186)
T PRK10078          2 GKLIWLMGPSGSGKDSLLA   20 (186)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            4678999999999999766


No 57 
>PRK05541 adenylylsulfate kinase; Provisional
Probab=92.74  E-value=0.056  Score=49.88  Aligned_cols=21  Identities=43%  Similarity=0.710  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|+||+||||++.
T Consensus         5 ~~~~~I~i~G~~GsGKst~a~   25 (176)
T PRK05541          5 PNGYVIWITGLAGSGKTTIAK   25 (176)
T ss_pred             CCCCEEEEEcCCCCCHHHHHH
Confidence            456789999999999999876


No 58 
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=92.70  E-value=0.061  Score=51.05  Aligned_cols=21  Identities=33%  Similarity=0.485  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|+||+|||||..
T Consensus        19 ~~G~~~~l~G~nG~GKSTLl~   39 (176)
T cd03238          19 PLNVLVVVTGVSGSGKSTLVN   39 (176)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 59 
>PRK00131 aroK shikimate kinase; Reviewed
Probab=92.59  E-value=0.059  Score=48.50  Aligned_cols=19  Identities=32%  Similarity=0.683  Sum_probs=17.0

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      +..++|+|++||||||++.
T Consensus         4 ~~~i~l~G~~GsGKstla~   22 (175)
T PRK00131          4 GPNIVLIGFMGAGKSTIGR   22 (175)
T ss_pred             CCeEEEEcCCCCCHHHHHH
Confidence            5679999999999999876


No 60 
>PRK00889 adenylylsulfate kinase; Provisional
Probab=92.40  E-value=0.062  Score=49.56  Aligned_cols=21  Identities=48%  Similarity=0.756  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..++|.|++|+||||++.
T Consensus         2 ~~g~~i~~~G~~GsGKST~a~   22 (175)
T PRK00889          2 QRGVTVWFTGLSGAGKTTIAR   22 (175)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            356789999999999999876


No 61 
>PRK05480 uridine/cytidine kinase; Provisional
Probab=92.36  E-value=0.065  Score=50.93  Aligned_cols=21  Identities=38%  Similarity=0.423  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..+..+.+.|.||||||||+.
T Consensus         4 ~~~~iI~I~G~sGsGKTTl~~   24 (209)
T PRK05480          4 KKPIIIGIAGGSGSGKTTVAS   24 (209)
T ss_pred             CCCEEEEEECCCCCCHHHHHH
Confidence            345689999999999999887


No 62 
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=92.35  E-value=0.076  Score=46.40  Aligned_cols=21  Identities=38%  Similarity=0.699  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|.+|+|||||..
T Consensus         9 ~~g~~~~i~G~nGsGKStLl~   29 (137)
T PF00005_consen    9 KPGEIVAIVGPNGSGKSTLLK   29 (137)
T ss_dssp             ETTSEEEEEESTTSSHHHHHH
T ss_pred             cCCCEEEEEccCCCcccccee
Confidence            468899999999999999765


No 63 
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein. Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif
Probab=92.26  E-value=0.025  Score=63.29  Aligned_cols=21  Identities=38%  Similarity=0.635  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|.||+|||||..
T Consensus       477 ~~Ge~vaIvG~sGsGKSTLlk  497 (686)
T TIGR03797       477 EPGEFVAIVGPSGSGKSTLLR  497 (686)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999776


No 64 
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=92.26  E-value=0.072  Score=50.38  Aligned_cols=21  Identities=43%  Similarity=0.748  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|+||+|||||..
T Consensus        25 ~~G~~~~l~G~nGsGKSTLl~   45 (211)
T cd03225          25 KKGEFVLIVGPNGSGKSTLLR   45 (211)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 65 
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=92.26  E-value=0.069  Score=56.37  Aligned_cols=21  Identities=48%  Similarity=0.714  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.-+.|.|+||||||||..
T Consensus        29 ~~Gef~~lLGPSGcGKTTlLR   49 (352)
T COG3842          29 KKGEFVTLLGPSGCGKTTLLR   49 (352)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            567889999999999999665


No 66 
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=92.19  E-value=0.079  Score=50.20  Aligned_cols=19  Identities=37%  Similarity=0.760  Sum_probs=17.8

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      +++++|+|.||+|||||.+
T Consensus        35 ~k~~vl~G~SGvGKSSLiN   53 (161)
T PF03193_consen   35 GKTSVLLGQSGVGKSSLIN   53 (161)
T ss_dssp             TSEEEEECSTTSSHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            5899999999999999877


No 67 
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=92.19  E-value=0.06  Score=45.97  Aligned_cols=16  Identities=56%  Similarity=0.804  Sum_probs=14.5

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      +++.|++|||||||+.
T Consensus         1 ill~G~~G~GKT~l~~   16 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLAR   16 (132)
T ss_dssp             EEEESSTTSSHHHHHH
T ss_pred             CEEECcCCCCeeHHHH
Confidence            5899999999999876


No 68 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=92.18  E-value=0.073  Score=44.79  Aligned_cols=20  Identities=45%  Similarity=0.657  Sum_probs=17.6

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+..+++.|++|+|||||+.
T Consensus        18 ~~~~v~i~G~~G~GKT~l~~   37 (151)
T cd00009          18 PPKNLLLYGPPGTGKTTLAR   37 (151)
T ss_pred             CCCeEEEECCCCCCHHHHHH
Confidence            45689999999999999876


No 69 
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=92.17  E-value=0.076  Score=51.66  Aligned_cols=20  Identities=30%  Similarity=0.652  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeCCCCCccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLS  351 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs  351 (490)
                      ..|..+.+.|+||||||||.
T Consensus        19 ~~Ge~~~l~G~sGsGKSTL~   38 (226)
T cd03270          19 PRNKLVVITGVSGSGKSSLA   38 (226)
T ss_pred             CCCcEEEEEcCCCCCHHHHH
Confidence            56889999999999999985


No 70 
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=92.16  E-value=0.059  Score=51.36  Aligned_cols=17  Identities=41%  Similarity=0.688  Sum_probs=15.7

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|+||+||||++.
T Consensus         2 riiilG~pGaGK~T~A~   18 (178)
T COG0563           2 RILILGPPGAGKSTLAK   18 (178)
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            47999999999999987


No 71 
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=92.08  E-value=0.08  Score=50.34  Aligned_cols=21  Identities=38%  Similarity=0.665  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~G~~~~l~G~nGsGKSTLl~   48 (218)
T cd03255          28 EKGEFVAIVGPSGSGKSTLLN   48 (218)
T ss_pred             cCCCEEEEEcCCCCCHHHHHH
Confidence            568899999999999999766


No 72 
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=92.07  E-value=0.099  Score=54.67  Aligned_cols=21  Identities=43%  Similarity=0.744  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ++|..++++|+||+|||||..
T Consensus        26 ~~Ge~vaLlGpSGaGKsTlLR   46 (345)
T COG1118          26 KSGELVALLGPSGAGKSTLLR   46 (345)
T ss_pred             cCCcEEEEECCCCCcHHHHHH
Confidence            689999999999999999765


No 73 
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=92.05  E-value=0.082  Score=49.41  Aligned_cols=21  Identities=38%  Similarity=0.684  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        16 ~~Ge~~~i~G~nGsGKSTLl~   36 (190)
T TIGR01166        16 ERGEVLALLGANGAGKSTLLL   36 (190)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 74 
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=92.02  E-value=0.082  Score=50.13  Aligned_cols=21  Identities=43%  Similarity=0.694  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~G~~~~l~G~nGsGKSTLl~   46 (214)
T TIGR02673        26 RKGEFLFLTGPSGAGKTTLLK   46 (214)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 75 
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=91.98  E-value=0.084  Score=50.23  Aligned_cols=21  Identities=33%  Similarity=0.692  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (216)
T TIGR00960        27 TKGEMVFLVGHSGAGKSTFLK   47 (216)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 76 
>PRK06762 hypothetical protein; Provisional
Probab=91.90  E-value=0.071  Score=48.57  Aligned_cols=18  Identities=39%  Similarity=0.636  Sum_probs=15.9

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|.|++||||||++.
T Consensus         3 ~li~i~G~~GsGKST~A~   20 (166)
T PRK06762          3 TLIIIRGNSGSGKTTIAK   20 (166)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            358899999999999887


No 77 
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.90  E-value=0.085  Score=49.96  Aligned_cols=21  Identities=33%  Similarity=0.561  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus        24 ~~G~~~~i~G~nGsGKSTLl~   44 (210)
T cd03269          24 EKGEIFGLLGPNGAGKTTTIR   44 (210)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 78 
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.85  E-value=0.088  Score=50.31  Aligned_cols=21  Identities=33%  Similarity=0.577  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (220)
T cd03265          24 RRGEIFGLLGPNGAGKTTTIK   44 (220)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 79 
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=91.83  E-value=0.088  Score=50.89  Aligned_cols=21  Identities=38%  Similarity=0.629  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        26 ~~Ge~~~l~G~nGsGKSTLl~   46 (243)
T TIGR02315        26 NPGEFVAIIGPSGAGKSTLLR   46 (243)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 80 
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=91.83  E-value=0.078  Score=51.67  Aligned_cols=21  Identities=38%  Similarity=0.588  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      .-|+.+++.|+||||||||..
T Consensus        27 ~~Ge~iaitGPSG~GKStllk   47 (223)
T COG4619          27 RAGEFIAITGPSGCGKSTLLK   47 (223)
T ss_pred             cCCceEEEeCCCCccHHHHHH
Confidence            457899999999999999754


No 81 
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=91.80  E-value=0.082  Score=53.56  Aligned_cols=48  Identities=25%  Similarity=0.246  Sum_probs=29.4

Q ss_pred             hhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCcccccc
Q 011221          303 EMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       303 EmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.+..+..++..++-..- + +......+..++|+|++||||||++.
T Consensus        29 ~vk~~i~e~~~~~~~~~~r~~-~-g~~~~~~~~~vll~G~pGTGKT~lA~   76 (284)
T TIGR02880        29 PVKTRIREIAALLLVERLRQR-L-GLASAAPTLHMSFTGNPGTGKTTVAL   76 (284)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-h-CCCcCCCCceEEEEcCCCCCHHHHHH
Confidence            678887777666433211110 0 11122235579999999999999884


No 82 
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=91.80  E-value=0.089  Score=49.74  Aligned_cols=21  Identities=38%  Similarity=0.642  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (205)
T cd03226          24 YAGEIIALTGKNGAGKTTLAK   44 (205)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 83 
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=91.80  E-value=0.091  Score=49.69  Aligned_cols=21  Identities=48%  Similarity=0.800  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.++++|++|+|||||..
T Consensus        24 ~~G~~~~l~G~nGsGKSTLl~   44 (213)
T cd03262          24 KKGEVVVIIGPSGSGKSTLLR   44 (213)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 84 
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=91.80  E-value=0.09  Score=50.41  Aligned_cols=21  Identities=38%  Similarity=0.680  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (227)
T cd03260          24 PKGEITALIGPSGCGKSTLLR   44 (227)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 85 
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=91.76  E-value=0.091  Score=52.29  Aligned_cols=21  Identities=43%  Similarity=0.714  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|+||||||||.+
T Consensus        29 a~ge~vv~lGpSGcGKTTLLn   49 (259)
T COG4525          29 ASGELVVVLGPSGCGKTTLLN   49 (259)
T ss_pred             cCCCEEEEEcCCCccHHHHHH
Confidence            568899999999999999766


No 86 
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=91.75  E-value=0.091  Score=49.71  Aligned_cols=21  Identities=38%  Similarity=0.681  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~G~~~~i~G~nGsGKSTLl~   45 (214)
T cd03292          25 SAGEFVFLVGPSGAGKSTLLK   45 (214)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 87 
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.69  E-value=0.093  Score=50.66  Aligned_cols=21  Identities=38%  Similarity=0.707  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (235)
T cd03261          24 RRGEILAIIGPSGSGKSTLLR   44 (235)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 88 
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=91.67  E-value=0.091  Score=50.56  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (236)
T cd03219          24 RPGEIHGLIGPNGAGKTTLFN   44 (236)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 89 
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=91.66  E-value=0.094  Score=50.02  Aligned_cols=21  Identities=43%  Similarity=0.672  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~   49 (228)
T cd03257          29 KKGETLGLVGESGSGKSTLAR   49 (228)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 90 
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.63  E-value=0.096  Score=49.73  Aligned_cols=21  Identities=43%  Similarity=0.645  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (213)
T cd03259          24 EPGEFLALLGPSGCGKTTLLR   44 (213)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 91 
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=91.62  E-value=0.084  Score=53.34  Aligned_cols=21  Identities=38%  Similarity=0.612  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.+..++|.||||||||+.
T Consensus        31 ~~Ge~lgivGeSGsGKSTL~r   51 (252)
T COG1124          31 ERGETLGIVGESGSGKSTLAR   51 (252)
T ss_pred             cCCCEEEEEcCCCCCHHHHHH
Confidence            458899999999999999876


No 92 
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=91.57  E-value=0.07  Score=42.74  Aligned_cols=16  Identities=38%  Similarity=0.544  Sum_probs=14.7

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      +++.|.+|+||||++.
T Consensus         2 i~i~G~~gsGKst~~~   17 (69)
T cd02019           2 IAITGGSGSGKSTVAK   17 (69)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6789999999999887


No 93 
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional
Probab=91.55  E-value=0.082  Score=56.43  Aligned_cols=21  Identities=38%  Similarity=0.868  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        52 ~~Gei~~LvG~NGsGKSTLLr   72 (400)
T PRK10070         52 EEGEIFVIMGLSGSGKSTMVR   72 (400)
T ss_pred             cCCCEEEEECCCCchHHHHHH
Confidence            568999999999999999766


No 94 
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=91.55  E-value=0.099  Score=49.64  Aligned_cols=21  Identities=38%  Similarity=0.616  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|+||+|||||..
T Consensus        23 ~~Ge~~~l~G~nGsGKSTLl~   43 (213)
T cd03235          23 KPGEFLAIVGPNGAGKSTLLK   43 (213)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 95 
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein.
Probab=91.52  E-value=0.028  Score=63.54  Aligned_cols=21  Identities=38%  Similarity=0.722  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|+||+|||||..
T Consensus       505 ~~Ge~vaIvG~SGsGKSTLl~  525 (711)
T TIGR00958       505 HPGEVVALVGPSGSGKSTVAA  525 (711)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 96 
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein. This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin.
Probab=91.48  E-value=0.032  Score=62.59  Aligned_cols=21  Identities=33%  Similarity=0.597  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.+++.|.||+|||||..
T Consensus       503 ~~Ge~vaIvG~sGsGKSTLlk  523 (710)
T TIGR03796       503 QPGQRVALVGGSGSGKSTIAK  523 (710)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 97 
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=91.47  E-value=0.1  Score=49.71  Aligned_cols=21  Identities=33%  Similarity=0.515  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (220)
T cd03263          26 YKGEIFGLLGHNGAGKTTTLK   46 (220)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 98 
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export.
Probab=91.46  E-value=0.034  Score=62.37  Aligned_cols=21  Identities=33%  Similarity=0.588  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.+++.|.||+|||||..
T Consensus       489 ~~G~~iaIvG~sGsGKSTLlk  509 (694)
T TIGR03375       489 RPGEKVAIIGRIGSGKSTLLK  509 (694)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 99 
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=91.42  E-value=0.098  Score=49.79  Aligned_cols=21  Identities=38%  Similarity=0.741  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (222)
T cd03224          24 PEGEIVALLGRNGAGKTTLLK   44 (222)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 100
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.39  E-value=0.11  Score=50.14  Aligned_cols=21  Identities=38%  Similarity=0.591  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        29 ~~Ge~~~l~G~nGsGKSTLl~   49 (233)
T cd03258          29 PKGEIFGIIGRSGAGKSTLIR   49 (233)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 101
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=91.32  E-value=0.11  Score=49.21  Aligned_cols=21  Identities=43%  Similarity=0.684  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.++++|++|+|||||..
T Consensus        24 ~~G~~~~i~G~nGsGKSTLl~   44 (208)
T cd03268          24 KKGEIYGFLGPNGAGKTTTMK   44 (208)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 102
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein. This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.
Probab=91.29  E-value=0.03  Score=61.00  Aligned_cols=21  Identities=38%  Similarity=0.651  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.+++.|.||+|||||..
T Consensus       364 ~~Ge~i~IvG~sGsGKSTLlk  384 (576)
T TIGR02204       364 RPGETVALVGPSGAGKSTLFQ  384 (576)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 103
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.28  E-value=0.1  Score=49.86  Aligned_cols=21  Identities=38%  Similarity=0.673  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~G~~~~i~G~nGsGKSTLl~   48 (220)
T cd03293          28 EEGEFVALVGPSGCGKSTLLR   48 (220)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 104
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=91.28  E-value=0.11  Score=49.53  Aligned_cols=21  Identities=38%  Similarity=0.667  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        29 ~~G~~~~i~G~nGsGKSTLl~   49 (221)
T TIGR02211        29 GKGEIVAIVGSSGSGKSTLLH   49 (221)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 105
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=91.27  E-value=0.11  Score=49.39  Aligned_cols=21  Identities=43%  Similarity=0.619  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|||||||..
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~   49 (218)
T cd03266          29 KPGEVTGLLGPNGAGKTTTLR   49 (218)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 106
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=91.25  E-value=0.11  Score=48.96  Aligned_cols=21  Identities=38%  Similarity=0.624  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|++|+|||||..
T Consensus        22 ~~Ge~~~i~G~nGsGKSTLl~   42 (206)
T TIGR03608        22 EKGKMYAIIGESGSGKSTLLN   42 (206)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 107
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=91.24  E-value=0.044  Score=62.52  Aligned_cols=21  Identities=38%  Similarity=0.585  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|.||||||||+.
T Consensus       497 ~~Ge~vaIvG~SGsGKSTL~K  517 (709)
T COG2274         497 PPGEKVAIVGRSGSGKSTLLK  517 (709)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            457889999999999999877


No 108
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=91.21  E-value=0.11  Score=49.83  Aligned_cols=21  Identities=43%  Similarity=0.675  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|||||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (230)
T TIGR03410        24 PKGEVTCVLGRNGVGKTTLLK   44 (230)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 109
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.20  E-value=0.11  Score=49.99  Aligned_cols=21  Identities=38%  Similarity=0.645  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (241)
T cd03256          25 NPGEFVALIGPSGAGKSTLLR   45 (241)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 110
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=91.18  E-value=0.1  Score=49.33  Aligned_cols=17  Identities=47%  Similarity=0.612  Sum_probs=15.4

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      ++.+.|+||+|||||+.
T Consensus         1 IIgI~G~sgSGKTTla~   17 (194)
T PF00485_consen    1 IIGIAGPSGSGKTTLAK   17 (194)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            47899999999999987


No 111
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=91.15  E-value=0.11  Score=51.59  Aligned_cols=43  Identities=26%  Similarity=0.319  Sum_probs=28.2

Q ss_pred             hhHHHHHHHHHHhcc-----cCCeeeeccccccCCCCCEEEEEeCCCCCcccccc
Q 011221          303 EMKKGLFSVMHYLMP-----KRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       303 EmKK~iltl~~~~l~-----~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.+..+.++...     ++|.-       .......++|+|++||||||++.
T Consensus        13 ~vk~~i~~~~~~~~~~~~~~~~g~~-------~~~~~~~vll~GppGtGKTtlA~   60 (261)
T TIGR02881        13 EVKALIKEIYAWIQINEKRKEEGLK-------TSKQVLHMIFKGNPGTGKTTVAR   60 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcCCC-------CCCCcceEEEEcCCCCCHHHHHH
Confidence            577777766655422     22222       22334579999999999999875


No 112
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=91.12  E-value=0.11  Score=50.27  Aligned_cols=21  Identities=33%  Similarity=0.673  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (242)
T PRK11124         26 PQGETLVLLGPSGAGKSSLLR   46 (242)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 113
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=91.12  E-value=0.064  Score=59.56  Aligned_cols=21  Identities=43%  Similarity=0.710  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.+++.|.||||||||..
T Consensus       345 ~~g~~talvG~SGaGKSTLl~  365 (559)
T COG4988         345 KAGQLTALVGASGAGKSTLLN  365 (559)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 114
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=91.12  E-value=0.12  Score=49.96  Aligned_cols=21  Identities=43%  Similarity=0.795  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (243)
T TIGR01978        24 KKGEIHAIMGPNGSGKSTLSK   44 (243)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 115
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=91.08  E-value=0.12  Score=47.72  Aligned_cols=21  Identities=38%  Similarity=0.722  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (163)
T cd03216          24 RRGEVHALLGENGAGKSTLMK   44 (163)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999766


No 116
>PRK03846 adenylylsulfate kinase; Provisional
Probab=91.03  E-value=0.1  Score=49.43  Aligned_cols=21  Identities=48%  Similarity=0.756  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..+..++|.|+||+|||||+.
T Consensus        22 ~~~~~i~i~G~~GsGKSTla~   42 (198)
T PRK03846         22 HKGVVLWFTGLSGSGKSTVAG   42 (198)
T ss_pred             CCCEEEEEECCCCCCHHHHHH
Confidence            557789999999999999877


No 117
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=91.01  E-value=0.12  Score=48.93  Aligned_cols=21  Identities=43%  Similarity=0.689  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (213)
T cd03301          24 ADGEFVVLLGPSGCGKTTTLR   44 (213)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 118
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=91.00  E-value=0.099  Score=52.39  Aligned_cols=18  Identities=56%  Similarity=0.885  Sum_probs=16.0

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      +.++|+|+.|+|||||+.
T Consensus        51 ~h~lf~GPPG~GKTTLA~   68 (233)
T PF05496_consen   51 DHMLFYGPPGLGKTTLAR   68 (233)
T ss_dssp             -EEEEESSTTSSHHHHHH
T ss_pred             ceEEEECCCccchhHHHH
Confidence            468999999999999987


No 119
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=90.96  E-value=0.12  Score=49.62  Aligned_cols=21  Identities=38%  Similarity=0.594  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (232)
T cd03218          24 KQGEIVGLLGPNGAGKTTTFY   44 (232)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 120
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=90.95  E-value=0.13  Score=48.00  Aligned_cols=21  Identities=33%  Similarity=0.638  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        23 ~~G~~~~l~G~nGsGKStLl~   43 (180)
T cd03214          23 EAGEIVGILGPNGAGKSTLLK   43 (180)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999755


No 121
>PRK10908 cell division protein FtsE; Provisional
Probab=90.92  E-value=0.12  Score=49.35  Aligned_cols=21  Identities=43%  Similarity=0.746  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (222)
T PRK10908         26 RPGEMAFLTGHSGAGKSTLLK   46 (222)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 122
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.88  E-value=0.13  Score=47.70  Aligned_cols=21  Identities=38%  Similarity=0.651  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.++++|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKStLl~   44 (173)
T cd03230          24 EKGEIYGLLGPNGAGKTTLIK   44 (173)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 123
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=90.87  E-value=0.11  Score=47.52  Aligned_cols=18  Identities=28%  Similarity=0.486  Sum_probs=16.1

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|+|++|+||||++.
T Consensus         4 ~ii~i~G~~GsGKsTl~~   21 (188)
T TIGR01360         4 KIIFIVGGPGSGKGTQCE   21 (188)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            468999999999999876


No 124
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=90.82  E-value=0.13  Score=49.57  Aligned_cols=21  Identities=29%  Similarity=0.336  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        11 ~~Ge~~~l~G~NGsGKSTLlk   31 (213)
T PRK15177         11 GYHEHIGILAAPGSGKTTLTR   31 (213)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 125
>PRK14738 gmk guanylate kinase; Provisional
Probab=90.79  E-value=0.12  Score=49.75  Aligned_cols=20  Identities=25%  Similarity=0.345  Sum_probs=17.2

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+..++|.|+||+|||||..
T Consensus        12 ~~~~ivi~GpsG~GK~tl~~   31 (206)
T PRK14738         12 KPLLVVISGPSGVGKDAVLA   31 (206)
T ss_pred             CCeEEEEECcCCCCHHHHHH
Confidence            45679999999999999765


No 126
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]
Probab=90.78  E-value=0.11  Score=50.53  Aligned_cols=20  Identities=40%  Similarity=0.586  Sum_probs=17.3

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .|..++++|+||+|||||..
T Consensus         3 ~G~l~vlsgPSG~GKsTl~k   22 (191)
T COG0194           3 KGLLIVLSGPSGVGKSTLVK   22 (191)
T ss_pred             CceEEEEECCCCCCHHHHHH
Confidence            46779999999999999754


No 127
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.77  E-value=0.13  Score=47.75  Aligned_cols=21  Identities=38%  Similarity=0.735  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|++|+|||||..
T Consensus        24 ~~G~~~~i~G~nGsGKSTLl~   44 (178)
T cd03229          24 EAGEIVALLGPSGSGKSTLLR   44 (178)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 128
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.77  E-value=0.12  Score=49.07  Aligned_cols=18  Identities=44%  Similarity=0.652  Sum_probs=16.5

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      | .+++.|+||+|||||..
T Consensus        26 g-~~~i~G~nGsGKSTLl~   43 (211)
T cd03264          26 G-MYGLLGPNGAGKTTLMR   43 (211)
T ss_pred             C-cEEEECCCCCCHHHHHH
Confidence            7 99999999999999765


No 129
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=90.77  E-value=0.1  Score=46.67  Aligned_cols=16  Identities=38%  Similarity=0.781  Sum_probs=14.7

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++|.|++|+||||++.
T Consensus         2 i~l~G~~GsGKST~a~   17 (150)
T cd02021           2 IVVMGVSGSGKSTVGK   17 (150)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999877


No 130
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=90.76  E-value=0.12  Score=49.00  Aligned_cols=21  Identities=48%  Similarity=0.659  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        23 ~~Ge~~~l~G~nGsGKSTLl~   43 (177)
T cd03222          23 KEGEVIGIVGPNGTGKTTAVK   43 (177)
T ss_pred             CCCCEEEEECCCCChHHHHHH
Confidence            568899999999999999766


No 131
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=90.75  E-value=0.13  Score=48.54  Aligned_cols=21  Identities=38%  Similarity=0.518  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~l~G~nGsGKSTLl~   45 (200)
T PRK13540         25 PAGGLLHLKGSNGAGKTTLLK   45 (200)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999765


No 132
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=90.72  E-value=0.13  Score=49.67  Aligned_cols=21  Identities=38%  Similarity=0.665  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        33 ~~Ge~~~l~G~nGsGKSTLl~   53 (233)
T PRK11629         33 GEGEMMAIVGSSGSGKSTLLH   53 (233)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999776


No 133
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=90.67  E-value=0.14  Score=47.41  Aligned_cols=21  Identities=38%  Similarity=0.662  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKStLl~   46 (173)
T cd03246          26 EPGESLAIIGPSGSGKSTLAR   46 (173)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 134
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=90.66  E-value=0.13  Score=47.16  Aligned_cols=21  Identities=48%  Similarity=0.545  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+++++.|+.|||||||+.
T Consensus        20 ~~~~~i~l~G~lGaGKTtl~~   40 (133)
T TIGR00150        20 DFGTVVLLKGDLGAGKTTLVQ   40 (133)
T ss_pred             CCCCEEEEEcCCCCCHHHHHH
Confidence            567899999999999999877


No 135
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=90.63  E-value=0.14  Score=48.81  Aligned_cols=21  Identities=38%  Similarity=0.618  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (207)
T PRK13539         26 AAGEALVLTGPNGSGKTTLLR   46 (207)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 136
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=90.59  E-value=0.14  Score=49.15  Aligned_cols=21  Identities=43%  Similarity=0.692  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        34 ~~Ge~~~i~G~nGsGKSTLl~   54 (228)
T PRK10584         34 KRGETIALIGESGSGKSTLLA   54 (228)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 137
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.58  E-value=0.14  Score=49.75  Aligned_cols=21  Identities=38%  Similarity=0.634  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (242)
T cd03295          25 AKGEFLVLIGPSGSGKTTTMK   45 (242)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 138
>PRK14527 adenylate kinase; Provisional
Probab=90.54  E-value=0.13  Score=48.30  Aligned_cols=20  Identities=35%  Similarity=0.654  Sum_probs=17.7

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+..++|+|++|+||||++.
T Consensus         5 ~~~~i~i~G~pGsGKsT~a~   24 (191)
T PRK14527          5 KNKVVIFLGPPGAGKGTQAE   24 (191)
T ss_pred             CCcEEEEECCCCCCHHHHHH
Confidence            46789999999999999876


No 139
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=90.54  E-value=0.14  Score=49.64  Aligned_cols=21  Identities=33%  Similarity=0.550  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus        27 ~~Ge~~~l~G~nGsGKSTLl~   47 (241)
T PRK10895         27 NSGEIVGLLGPNGAGKTTTFY   47 (241)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 140
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=90.52  E-value=0.14  Score=48.51  Aligned_cols=21  Identities=33%  Similarity=0.558  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~l~G~nGsGKSTLl~   45 (204)
T PRK13538         25 NAGELVQIEGPNGAGKTSLLR   45 (204)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 141
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.51  E-value=0.14  Score=49.62  Aligned_cols=21  Identities=43%  Similarity=0.714  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (239)
T cd03296          26 PSGELVALLGPSGSGKTTLLR   46 (239)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 142
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=90.50  E-value=0.13  Score=50.10  Aligned_cols=21  Identities=43%  Similarity=0.542  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|+||+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (253)
T TIGR02323        27 YPGEVLGIVGESGSGKSTLLG   47 (253)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 143
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.47  E-value=0.14  Score=49.94  Aligned_cols=21  Identities=38%  Similarity=0.515  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        28 ~~Ge~~~l~G~nGsGKSTLl~   48 (253)
T PRK14267         28 PQNGVFALMGPSGCGKSTLLR   48 (253)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 144
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=90.47  E-value=0.14  Score=49.48  Aligned_cols=21  Identities=33%  Similarity=0.686  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (236)
T TIGR03864        25 RPGEFVALLGPNGAGKSTLFS   45 (236)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 145
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.46  E-value=0.15  Score=48.94  Aligned_cols=21  Identities=43%  Similarity=0.672  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~G~~~~i~G~nGsGKSTLl~   47 (229)
T cd03254          27 KPGETVAIVGPTGAGKTTLIN   47 (229)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 146
>PF13479 AAA_24:  AAA domain
Probab=90.44  E-value=0.16  Score=49.06  Aligned_cols=28  Identities=36%  Similarity=0.453  Sum_probs=20.9

Q ss_pred             CCEEEEEeCCCCCcccccccCCCceeec
Q 011221          334 GDVALFFGLSGTGKTTLSTDHNRYLIGD  361 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~~~~~~lI~D  361 (490)
                      +-.++++|.||+||||++..-.+.|+-|
T Consensus         3 ~~~~lIyG~~G~GKTt~a~~~~k~l~id   30 (213)
T PF13479_consen    3 PIKILIYGPPGSGKTTLAASLPKPLFID   30 (213)
T ss_pred             ceEEEEECCCCCCHHHHHHhCCCeEEEE
Confidence            4468999999999999887544544433


No 147
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=90.43  E-value=0.14  Score=50.53  Aligned_cols=21  Identities=43%  Similarity=0.719  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (255)
T PRK11248         25 ESGELLVVLGPSGCGKTTLLN   45 (255)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 148
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=90.43  E-value=0.1  Score=48.12  Aligned_cols=17  Identities=35%  Similarity=0.561  Sum_probs=15.2

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      +++++|++|+||||++.
T Consensus         1 ~i~i~G~pGsGKst~a~   17 (183)
T TIGR01359         1 VVFVLGGPGSGKGTQCA   17 (183)
T ss_pred             CEEEECCCCCCHHHHHH
Confidence            37899999999999876


No 149
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism]
Probab=90.42  E-value=0.085  Score=50.50  Aligned_cols=22  Identities=45%  Similarity=0.684  Sum_probs=19.7

Q ss_pred             CCCCEEEEEeCCCCCccccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLSTD  353 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~~  353 (490)
                      +.|-++-+.||||+|||||++.
T Consensus        29 qkGcviWiTGLSgSGKStlACa   50 (207)
T KOG0635|consen   29 QKGCVIWITGLSGSGKSTLACA   50 (207)
T ss_pred             CCCcEEEEeccCCCCchhHHHH
Confidence            5678999999999999999883


No 150
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=90.42  E-value=0.15  Score=47.11  Aligned_cols=21  Identities=52%  Similarity=0.680  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (166)
T cd03223          25 KPGDRLLITGPSGTGKSSLFR   45 (166)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 151
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.33  E-value=0.15  Score=49.69  Aligned_cols=21  Identities=38%  Similarity=0.646  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14247         27 PDNTITALMGPSGSGKSTLLR   47 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 152
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=90.29  E-value=0.11  Score=48.73  Aligned_cols=16  Identities=44%  Similarity=0.493  Sum_probs=14.7

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      +.+.|+||||||||+.
T Consensus         2 igi~G~~GsGKSTl~~   17 (198)
T cd02023           2 IGIAGGSGSGKTTVAE   17 (198)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6789999999999887


No 153
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=90.28  E-value=0.15  Score=48.46  Aligned_cols=21  Identities=33%  Similarity=0.607  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        28 ~~G~~~~i~G~nGsGKSTLl~   48 (220)
T cd03245          28 RAGEKVAIIGRVGSGKSTLLK   48 (220)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 154
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=90.27  E-value=0.15  Score=47.52  Aligned_cols=21  Identities=33%  Similarity=0.658  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~G~~~~i~G~nGsGKSTLl~   44 (182)
T cd03215          24 RAGEIVGIAGLVGNGQTELAE   44 (182)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 155
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=90.26  E-value=0.15  Score=53.41  Aligned_cols=21  Identities=48%  Similarity=0.711  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||||||||..
T Consensus        28 ~~Ge~~~l~GpsGsGKSTLLr   48 (353)
T TIGR03265        28 KKGEFVCLLGPSGCGKTTLLR   48 (353)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999665


No 156
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=90.24  E-value=0.13  Score=44.20  Aligned_cols=21  Identities=33%  Similarity=0.517  Sum_probs=13.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +++..+++.|++|+|||++..
T Consensus         2 ~~~~~~~i~G~~G~GKT~~~~   22 (131)
T PF13401_consen    2 QSQRILVISGPPGSGKTTLIK   22 (131)
T ss_dssp             -----EEEEE-TTSSHHHHHH
T ss_pred             CCCcccEEEcCCCCCHHHHHH
Confidence            345679999999999999766


No 157
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=90.24  E-value=0.15  Score=50.22  Aligned_cols=21  Identities=43%  Similarity=0.640  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        37 ~~Ge~~~i~G~nGsGKSTLl~   57 (260)
T PRK10744         37 AKNQVTAFIGPSGCGKSTLLR   57 (260)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 158
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=90.22  E-value=0.15  Score=49.79  Aligned_cols=21  Identities=33%  Similarity=0.561  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        30 ~~Ge~~~i~G~nGsGKSTLl~   50 (253)
T PRK14242         30 EQNQVTALIGPSGCGKSTFLR   50 (253)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 159
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.22  E-value=0.16  Score=48.19  Aligned_cols=21  Identities=38%  Similarity=0.702  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        22 ~~Ge~~~l~G~nGsGKSTLl~   42 (211)
T cd03298          22 AQGEITAIVGPSGSGKSTLLN   42 (211)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 160
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=90.21  E-value=0.16  Score=49.57  Aligned_cols=21  Identities=38%  Similarity=0.558  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (247)
T TIGR00972        25 PKNQVTALIGPSGCGKSTLLR   45 (247)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 161
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=90.21  E-value=0.16  Score=47.93  Aligned_cols=21  Identities=38%  Similarity=0.520  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (198)
T TIGR01189        24 NAGEALQVTGPNGIGKTTLLR   44 (198)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 162
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=90.14  E-value=0.17  Score=45.91  Aligned_cols=21  Identities=38%  Similarity=0.550  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKStLl~   44 (144)
T cd03221          24 NPGDRIGLVGRNGAGKSTLLK   44 (144)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 163
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=90.13  E-value=0.16  Score=47.05  Aligned_cols=21  Identities=43%  Similarity=0.700  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKStLl~   46 (178)
T cd03247          26 KQGEKIALLGRSGSGKSTLLQ   46 (178)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 164
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=90.10  E-value=0.16  Score=49.41  Aligned_cols=21  Identities=52%  Similarity=0.749  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK11264         27 KPGEVVAIIGPSGSGKTTLLR   47 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 165
>PRK06547 hypothetical protein; Provisional
Probab=90.10  E-value=0.13  Score=48.56  Aligned_cols=17  Identities=53%  Similarity=0.669  Sum_probs=15.3

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .+++.|+||||||||+.
T Consensus        17 ~i~i~G~~GsGKTt~a~   33 (172)
T PRK06547         17 TVLIDGRSGSGKTTLAG   33 (172)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58888999999999877


No 166
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=90.07  E-value=0.11  Score=47.36  Aligned_cols=17  Identities=47%  Similarity=0.786  Sum_probs=15.2

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      +++|.|++|+|||||+.
T Consensus         1 ~i~i~G~~GsGKSTla~   17 (149)
T cd02027           1 VIWLTGLSGSGKSTIAR   17 (149)
T ss_pred             CEEEEcCCCCCHHHHHH
Confidence            37899999999999887


No 167
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=90.06  E-value=0.16  Score=49.98  Aligned_cols=21  Identities=38%  Similarity=0.583  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (258)
T PRK14241         28 EPRSVTAFIGPSGCGKSTVLR   48 (258)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 168
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.06  E-value=0.16  Score=49.52  Aligned_cols=21  Identities=29%  Similarity=0.547  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        29 ~~Ge~~~l~G~nGsGKSTLl~   49 (252)
T PRK14255         29 NQNEITALIGPSGCGKSTYLR   49 (252)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 169
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=90.02  E-value=0.16  Score=50.53  Aligned_cols=21  Identities=38%  Similarity=0.540  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        36 ~~Ge~~~I~G~NGsGKSTLlk   56 (257)
T PRK11247         36 PAGQFVAVVGRSGCGKSTLLR   56 (257)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 170
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.01  E-value=0.16  Score=49.63  Aligned_cols=21  Identities=29%  Similarity=0.491  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (254)
T PRK14273         31 LKNSITALIGPSGCGKSTFLR   51 (254)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 171
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.
Probab=90.00  E-value=0.16  Score=48.91  Aligned_cols=21  Identities=38%  Similarity=0.626  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus         4 ~~Ge~~~l~G~nGsGKSTLl~   24 (223)
T TIGR03771         4 DKGELLGLLGPNGAGKTTLLR   24 (223)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            358899999999999999766


No 172
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=89.98  E-value=0.14  Score=45.11  Aligned_cols=16  Identities=56%  Similarity=0.827  Sum_probs=14.7

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      +++.|++|||||+|+.
T Consensus         2 vlL~G~~G~GKt~l~~   17 (139)
T PF07728_consen    2 VLLVGPPGTGKTTLAR   17 (139)
T ss_dssp             EEEEESSSSSHHHHHH
T ss_pred             EEEECCCCCCHHHHHH
Confidence            7899999999999876


No 173
>PRK03839 putative kinase; Provisional
Probab=89.97  E-value=0.13  Score=47.73  Aligned_cols=17  Identities=41%  Similarity=0.610  Sum_probs=15.2

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|++|+||||++.
T Consensus         2 ~I~l~G~pGsGKsT~~~   18 (180)
T PRK03839          2 IIAITGTPGVGKTTVSK   18 (180)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999876


No 174
>PRK09183 transposase/IS protein; Provisional
Probab=89.95  E-value=0.14  Score=51.20  Aligned_cols=20  Identities=35%  Similarity=0.587  Sum_probs=17.8

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .|..++|+|++|||||+|+.
T Consensus       101 ~~~~v~l~Gp~GtGKThLa~  120 (259)
T PRK09183        101 RNENIVLLGPSGVGKTHLAI  120 (259)
T ss_pred             cCCeEEEEeCCCCCHHHHHH
Confidence            46789999999999999877


No 175
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=89.93  E-value=0.17  Score=49.09  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus         9 ~~Ge~~~i~G~nGsGKSTLl~   29 (230)
T TIGR01184         9 QQGEFISLIGHSGCGKSTLLN   29 (230)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 176
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=89.91  E-value=0.17  Score=48.78  Aligned_cols=21  Identities=43%  Similarity=0.676  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (225)
T PRK10247         31 RAGEFKLITGPSGCGKSTLLK   51 (225)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 177
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=89.90  E-value=0.13  Score=45.57  Aligned_cols=16  Identities=38%  Similarity=0.750  Sum_probs=14.8

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++++|++||||||++.
T Consensus         2 i~l~G~~GsGKstla~   17 (154)
T cd00464           2 IVLIGMMGAGKTTVGR   17 (154)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            7899999999999887


No 178
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=89.88  E-value=0.17  Score=47.94  Aligned_cols=21  Identities=38%  Similarity=0.534  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.++|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (201)
T cd03231          24 AAGEALQVTGPNGSGKTTLLR   44 (201)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 179
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=89.87  E-value=0.17  Score=49.43  Aligned_cols=21  Identities=33%  Similarity=0.599  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (252)
T TIGR03005        24 AAGEKVALIGPSGSGKSTILR   44 (252)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 180
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=89.85  E-value=0.12  Score=45.04  Aligned_cols=16  Identities=56%  Similarity=0.891  Sum_probs=14.5

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++++|.+|+||||++.
T Consensus         2 ~~i~G~~G~GKT~l~~   17 (165)
T cd01120           2 ILVFGPTGSGKTTLAL   17 (165)
T ss_pred             eeEeCCCCCCHHHHHH
Confidence            6899999999999776


No 181
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=89.84  E-value=0.18  Score=48.31  Aligned_cols=21  Identities=43%  Similarity=0.590  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus        35 ~~Ge~~~i~G~nGsGKSTLl~   55 (214)
T PRK13543         35 DAGEALLVQGDNGAGKTTLLR   55 (214)
T ss_pred             CCCCEEEEEcCCCCCHHHHHH
Confidence            468899999999999999765


No 182
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=89.84  E-value=0.18  Score=48.29  Aligned_cols=21  Identities=38%  Similarity=0.594  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        32 ~~Ge~~~l~G~nGsGKSTLl~   52 (224)
T TIGR02324        32 NAGECVALSGPSGAGKSTLLK   52 (224)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 183
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.82  E-value=0.17  Score=50.14  Aligned_cols=21  Identities=29%  Similarity=0.571  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||+|||||..
T Consensus        33 ~~Ge~~~I~G~nGsGKSTLl~   53 (269)
T PRK13648         33 PKGQWTSIVGHNGSGKSTIAK   53 (269)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 184
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=89.82  E-value=0.17  Score=49.24  Aligned_cols=21  Identities=33%  Similarity=0.570  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~   49 (252)
T PRK14239         29 YPNEITALIGPSGSGKSTLLR   49 (252)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 185
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=89.82  E-value=0.17  Score=48.94  Aligned_cols=21  Identities=43%  Similarity=0.764  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        25 ~~Ge~~~l~G~nGsGKSTLl~   45 (240)
T PRK09493         25 DQGEVVVIIGPSGSGKSTLLR   45 (240)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 186
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=89.80  E-value=0.18  Score=48.74  Aligned_cols=21  Identities=38%  Similarity=0.635  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        23 ~~Ge~~~l~G~nGsGKSTLl~   43 (232)
T PRK10771         23 ERGERVAILGPSGAGKSTLLN   43 (232)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 187
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.
Probab=89.80  E-value=0.18  Score=48.77  Aligned_cols=21  Identities=38%  Similarity=0.586  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        10 ~~Ge~~~i~G~nGsGKSTLl~   30 (230)
T TIGR02770        10 KRGEVLALVGESGSGKSLTCL   30 (230)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 188
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=89.77  E-value=0.18  Score=47.58  Aligned_cols=21  Identities=29%  Similarity=0.613  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        29 ~~G~~~~i~G~nG~GKSTLl~   49 (204)
T cd03250          29 PKGELVAIVGPVGSGKSSLLS   49 (204)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578899999999999999765


No 189
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=89.77  E-value=0.17  Score=48.90  Aligned_cols=21  Identities=33%  Similarity=0.678  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Ge~~~l~G~nGsGKSTLl~   46 (242)
T TIGR03411        26 DPGELRVIIGPNGAGKTTMMD   46 (242)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999755


No 190
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=89.76  E-value=0.18  Score=48.33  Aligned_cols=21  Identities=33%  Similarity=0.474  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (223)
T TIGR03740        24 PKNSVYGLLGPNGAGKSTLLK   44 (223)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 191
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=89.73  E-value=0.18  Score=49.94  Aligned_cols=21  Identities=38%  Similarity=0.608  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        35 ~~Ge~~~i~G~nGsGKSTLl~   55 (265)
T PRK10575         35 PAGKVTGLIGHNGSGKSTLLK   55 (265)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 192
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=89.71  E-value=0.18  Score=48.64  Aligned_cols=21  Identities=48%  Similarity=0.732  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (237)
T cd03252          26 KPGEVVGIVGRSGSGKSTLTK   46 (237)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 193
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3. cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.
Probab=89.70  E-value=0.17  Score=55.63  Aligned_cols=21  Identities=24%  Similarity=0.483  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||+|||||..
T Consensus        30 ~~GEiv~L~G~SGsGKSTLLr   50 (504)
T TIGR03238        30 PSSSLLFLCGSSGDGKSEILA   50 (504)
T ss_pred             cCCCEEEEECCCCCCHHHHHh
Confidence            468899999999999999766


No 194
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.69  E-value=0.18  Score=49.11  Aligned_cols=21  Identities=38%  Similarity=0.605  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (241)
T PRK14250         27 EGGAIYTIVGPSGAGKSTLIK   47 (241)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 195
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=89.68  E-value=0.18  Score=49.12  Aligned_cols=21  Identities=38%  Similarity=0.757  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (252)
T CHL00131         31 NKGEIHAIMGPNGSGKSTLSK   51 (252)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 196
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=89.67  E-value=0.19  Score=48.54  Aligned_cols=21  Identities=33%  Similarity=0.567  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~Ge~~~l~G~nGsGKSTLl~   47 (238)
T cd03249          27 PPGKTVALVGSSGCGKSTVVS   47 (238)
T ss_pred             cCCCEEEEEeCCCCCHHHHHH
Confidence            568999999999999999766


No 197
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=89.65  E-value=0.14  Score=46.24  Aligned_cols=16  Identities=44%  Similarity=0.607  Sum_probs=14.4

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++|.|+||+|||||+.
T Consensus         2 i~i~GpsGsGKstl~~   17 (137)
T cd00071           2 IVLSGPSGVGKSTLLK   17 (137)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6889999999999776


No 198
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.65  E-value=0.17  Score=47.63  Aligned_cols=21  Identities=48%  Similarity=0.695  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~l~G~nGsGKSTLl~   51 (192)
T cd03232          31 KPGTLTALMGESGAGKTTLLD   51 (192)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 199
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=89.64  E-value=0.18  Score=49.84  Aligned_cols=21  Identities=33%  Similarity=0.531  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        23 ~~Ge~~~i~G~NGsGKSTLlk   43 (246)
T cd03237          23 SESEVIGILGPNGIGKTTFIK   43 (246)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 200
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=89.64  E-value=0.27  Score=47.82  Aligned_cols=21  Identities=38%  Similarity=0.662  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        45 ~~Ge~~~i~G~NGsGKSTLl~   65 (236)
T cd03267          45 EKGEIVGFIGPNGAGKTTTLK   65 (236)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 201
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=89.63  E-value=0.17  Score=49.30  Aligned_cols=21  Identities=29%  Similarity=0.602  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        29 ~~Ge~~~l~G~nGsGKSTLl~   49 (255)
T PRK11300         29 REQEIVSLIGPNGAGKTTVFN   49 (255)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 202
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.62  E-value=0.18  Score=49.53  Aligned_cols=21  Identities=33%  Similarity=0.583  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        36 ~~Ge~~~l~G~nGsGKSTLl~   56 (259)
T PRK14274         36 PENEVTAIIGPSGCGKSTFIK   56 (259)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 203
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=89.60  E-value=0.18  Score=52.79  Aligned_cols=21  Identities=43%  Similarity=0.667  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||||||||..
T Consensus        30 ~~Ge~~~llGpsGsGKSTLLr   50 (351)
T PRK11432         30 KQGTMVTLLGPSGCGKTTVLR   50 (351)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            468899999999999999765


No 204
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.59  E-value=0.18  Score=49.06  Aligned_cols=21  Identities=38%  Similarity=0.510  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14262         27 FKNQITAIIGPSGCGKTTLLR   47 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 205
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=89.56  E-value=0.23  Score=50.37  Aligned_cols=21  Identities=38%  Similarity=0.678  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.-+++.|+||+|||||..
T Consensus        28 ~~GE~VaiIG~SGaGKSTLLR   48 (258)
T COG3638          28 NQGEMVAIIGPSGAGKSTLLR   48 (258)
T ss_pred             CCCcEEEEECCCCCcHHHHHH
Confidence            567889999999999999866


No 206
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=89.54  E-value=0.19  Score=49.99  Aligned_cols=21  Identities=43%  Similarity=0.640  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (269)
T PRK11831         31 PRGKITAIMGPSGIGKTTLLR   51 (269)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 207
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=89.54  E-value=0.18  Score=53.40  Aligned_cols=21  Identities=38%  Similarity=0.648  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||||||||..
T Consensus        38 ~~Ge~~~LlGpsGsGKSTLLr   58 (375)
T PRK09452         38 NNGEFLTLLGPSGCGKTTVLR   58 (375)
T ss_pred             eCCCEEEEECCCCCcHHHHHH
Confidence            468899999999999999665


No 208
>PRK14530 adenylate kinase; Provisional
Probab=89.52  E-value=0.17  Score=48.62  Aligned_cols=19  Identities=37%  Similarity=0.524  Sum_probs=16.8

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      +..++|+|++|+||||++.
T Consensus         3 ~~~I~i~G~pGsGKsT~~~   21 (215)
T PRK14530          3 QPRILLLGAPGAGKGTQSS   21 (215)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            4579999999999999877


No 209
>CHL00181 cbbX CbbX; Provisional
Probab=89.52  E-value=0.17  Score=51.48  Aligned_cols=48  Identities=29%  Similarity=0.367  Sum_probs=28.6

Q ss_pred             hhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCcccccc
Q 011221          303 EMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       303 EmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+-+..+..++...+  +--+-+......|..++|+|++||||||++.
T Consensus        30 ~vK~~i~e~~~~~~~~~--~~~~~g~~~~~~~~~ill~G~pGtGKT~lAr   77 (287)
T CHL00181         30 PVKTRIREIAALLLIDR--LRKNLGLTSSNPGLHMSFTGSPGTGKTTVAL   77 (287)
T ss_pred             HHHHHHHHHHHHHHHHH--HHHHcCCCCCCCCceEEEECCCCCCHHHHHH
Confidence            57777766665433211  0001121122346679999999999999877


No 210
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.52  E-value=0.19  Score=49.79  Aligned_cols=21  Identities=33%  Similarity=0.507  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        45 ~~Ge~~~i~G~nGsGKSTLl~   65 (268)
T PRK14248         45 EKHAVTALIGPSGCGKSTFLR   65 (268)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 211
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.52  E-value=0.18  Score=50.62  Aligned_cols=21  Identities=33%  Similarity=0.602  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        35 ~~Ge~~~l~G~nGsGKSTLl~   55 (289)
T PRK13645         35 KKNKVTCVIGTTGSGKSTMIQ   55 (289)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 212
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.50  E-value=0.18  Score=50.14  Aligned_cols=21  Identities=38%  Similarity=0.775  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~l~G~nGsGKSTLl~   51 (280)
T PRK13649         31 EDGSYTAFIGHTGSGKSTIMQ   51 (280)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 213
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=89.49  E-value=0.14  Score=46.45  Aligned_cols=21  Identities=38%  Similarity=0.438  Sum_probs=13.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..+..+++.|++|+|||+|..
T Consensus        22 ~~~~~~ll~G~~G~GKT~ll~   42 (185)
T PF13191_consen   22 GSPRNLLLTGESGSGKTSLLR   42 (185)
T ss_dssp             -----EEE-B-TTSSHHHHHH
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            345789999999999999766


No 214
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=89.48  E-value=0.18  Score=52.79  Aligned_cols=21  Identities=43%  Similarity=0.713  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.++|+||||||||..
T Consensus        28 ~~Ge~~~llG~sGsGKSTLLr   48 (356)
T PRK11650         28 ADGEFIVLVGPSGCGKSTLLR   48 (356)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            468899999999999999765


No 215
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines.
Probab=89.46  E-value=0.16  Score=54.00  Aligned_cols=21  Identities=38%  Similarity=0.914  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||+|||||..
T Consensus        48 ~~Gei~~I~G~nGsGKSTLlr   68 (382)
T TIGR03415        48 EEGEICVLMGLSGSGKSSLLR   68 (382)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568999999999999999766


No 216
>PTZ00301 uridine kinase; Provisional
Probab=89.45  E-value=0.15  Score=49.72  Aligned_cols=17  Identities=53%  Similarity=0.659  Sum_probs=15.6

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .+.+-|.||+|||||+.
T Consensus         5 iIgIaG~SgSGKTTla~   21 (210)
T PTZ00301          5 VIGISGASGSGKSSLST   21 (210)
T ss_pred             EEEEECCCcCCHHHHHH
Confidence            58899999999999986


No 217
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=89.43  E-value=0.19  Score=49.98  Aligned_cols=21  Identities=38%  Similarity=0.722  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~l~G~nGsGKSTLl~   51 (272)
T PRK15056         31 PGGSIAALVGVNGSGKSTLFK   51 (272)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 218
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=89.40  E-value=0.18  Score=43.08  Aligned_cols=16  Identities=31%  Similarity=0.472  Sum_probs=14.6

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++|+|.+|+|||||-.
T Consensus         2 V~iiG~~~~GKSTlin   17 (116)
T PF01926_consen    2 VAIIGRPNVGKSTLIN   17 (116)
T ss_dssp             EEEEESTTSSHHHHHH
T ss_pred             EEEECCCCCCHHHHHH
Confidence            7899999999999766


No 219
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=89.37  E-value=0.2  Score=48.86  Aligned_cols=21  Identities=33%  Similarity=0.589  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14240         27 EENQVTALIGPSGCGKSTFLR   47 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 220
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=89.36  E-value=0.19  Score=43.56  Aligned_cols=19  Identities=26%  Similarity=0.433  Sum_probs=16.4

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      |-.++++|++|+|||||..
T Consensus         1 ~~~i~l~G~~~~GKstli~   19 (157)
T cd04164           1 GIKVVIVGKPNVGKSSLLN   19 (157)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            4568999999999999765


No 221
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=89.33  E-value=0.23  Score=50.36  Aligned_cols=30  Identities=30%  Similarity=0.581  Sum_probs=22.9

Q ss_pred             eeccccccC-CCCCEEEEEeCCCCCcccccc
Q 011221          323 SLHSGCNMG-KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       323 ~~H~sani~-~~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+|-+.++. ..|....|+|+||||||||..
T Consensus        22 ~Ild~v~l~V~~Gei~~iiGgSGsGKStlLr   52 (263)
T COG1127          22 VILDGVDLDVPRGEILAILGGSGSGKSTLLR   52 (263)
T ss_pred             EEecCceeeecCCcEEEEECCCCcCHHHHHH
Confidence            344444444 568899999999999999766


No 222
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.28  E-value=0.2  Score=49.86  Aligned_cols=21  Identities=38%  Similarity=0.602  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        37 ~~Ge~~~l~G~nGsGKSTLl~   57 (269)
T PRK14259         37 PRGKVTALIGPSGCGKSTVLR   57 (269)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 223
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=89.28  E-value=0.2  Score=47.11  Aligned_cols=21  Identities=24%  Similarity=0.408  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (195)
T PRK13541         24 LPSAITYIKGANGCGKSSLLR   44 (195)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 224
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=89.27  E-value=0.21  Score=47.31  Aligned_cols=21  Identities=38%  Similarity=0.544  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        32 ~~G~~~~i~G~nGsGKSTLl~   52 (207)
T cd03369          32 KAGEKIGIVGRTGAGKSTLIL   52 (207)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 225
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=89.24  E-value=0.21  Score=47.59  Aligned_cols=21  Identities=33%  Similarity=0.545  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (221)
T cd03244          28 KPGEKVGIVGRTGSGKSSLLL   48 (221)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 226
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=89.20  E-value=0.2  Score=47.77  Aligned_cols=21  Identities=43%  Similarity=0.764  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        22 ~~Ge~~~i~G~nGsGKSTLl~   42 (213)
T TIGR01277        22 ADGEIVAIMGPSGAGKSTLLN   42 (213)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 227
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=89.19  E-value=0.16  Score=47.29  Aligned_cols=18  Identities=44%  Similarity=0.704  Sum_probs=16.2

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      +.++|.|.+|||||||..
T Consensus         2 krimliG~~g~GKTTL~q   19 (143)
T PF10662_consen    2 KRIMLIGPSGSGKTTLAQ   19 (143)
T ss_pred             ceEEEECCCCCCHHHHHH
Confidence            358999999999999987


No 228
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.19  E-value=0.21  Score=48.00  Aligned_cols=21  Identities=38%  Similarity=0.656  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (234)
T cd03251          26 PAGETVALVGPSGSGKSTLVN   46 (234)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 229
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.18  E-value=0.21  Score=48.88  Aligned_cols=21  Identities=33%  Similarity=0.536  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (252)
T PRK14256         28 PENSVTAIIGPSGCGKSTVLR   48 (252)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 230
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=89.16  E-value=0.2  Score=53.00  Aligned_cols=21  Identities=38%  Similarity=0.643  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||||||||..
T Consensus        43 ~~Ge~~~llGpsGsGKSTLLr   63 (377)
T PRK11607         43 YKGEIFALLGASGCGKSTLLR   63 (377)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            468899999999999999755


No 231
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=89.16  E-value=0.2  Score=49.21  Aligned_cols=21  Identities=48%  Similarity=0.583  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        30 ~~Ge~~~i~G~nGsGKSTLl~   50 (258)
T PRK11701         30 YPGEVLGIVGESGSGKTTLLN   50 (258)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 232
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.16  E-value=0.22  Score=46.04  Aligned_cols=21  Identities=43%  Similarity=0.643  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~G~~~~l~G~nGsGKstLl~   46 (171)
T cd03228          26 KPGEKVAIVGPSGSGKSTLLK   46 (171)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 233
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=89.16  E-value=0.16  Score=48.98  Aligned_cols=18  Identities=39%  Similarity=0.532  Sum_probs=15.9

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      .+++|.|++|+||||+.+
T Consensus         2 ~vi~lvGptGvGKTTt~a   19 (196)
T PF00448_consen    2 KVIALVGPTGVGKTTTIA   19 (196)
T ss_dssp             EEEEEEESTTSSHHHHHH
T ss_pred             EEEEEECCCCCchHhHHH
Confidence            468999999999999766


No 234
>PRK06696 uridine kinase; Validated
Probab=89.16  E-value=0.17  Score=48.96  Aligned_cols=18  Identities=28%  Similarity=0.375  Sum_probs=16.3

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      -.+++-|.||||||||+.
T Consensus        23 ~iI~I~G~sgsGKSTlA~   40 (223)
T PRK06696         23 LRVAIDGITASGKTTFAD   40 (223)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            369999999999999887


No 235
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=89.15  E-value=0.2  Score=52.12  Aligned_cols=21  Identities=38%  Similarity=0.619  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||||||||..
T Consensus        22 ~~Ge~~~l~G~nGsGKSTLl~   42 (352)
T PRK11144         22 PAQGITAIFGRSGAGKTSLIN   42 (352)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 236
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=89.14  E-value=0.17  Score=43.93  Aligned_cols=16  Identities=38%  Similarity=0.526  Sum_probs=14.5

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++++|.+|+|||||..
T Consensus         2 i~l~G~~g~GKTtL~~   17 (170)
T cd01876           2 IAFAGRSNVGKSSLIN   17 (170)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999876


No 237
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.13  E-value=0.21  Score=49.69  Aligned_cols=21  Identities=33%  Similarity=0.733  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        33 ~~Ge~~~l~G~nGsGKSTLl~   53 (271)
T PRK13632         33 NEGEYVAILGHNGSGKSTISK   53 (271)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999755


No 238
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=89.13  E-value=0.21  Score=47.62  Aligned_cols=21  Identities=29%  Similarity=0.583  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (218)
T cd03290          25 PTGQLTMIVGQVGCGKSSLLL   45 (218)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 239
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=89.13  E-value=0.21  Score=47.79  Aligned_cols=21  Identities=38%  Similarity=0.697  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        38 ~~Ge~~~i~G~nGsGKSTLl~   58 (226)
T cd03248          38 HPGEVTALVGPSGSGKSTVVA   58 (226)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 240
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=89.12  E-value=0.21  Score=49.05  Aligned_cols=21  Identities=43%  Similarity=0.676  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.++++|.||+|||||..
T Consensus        29 ~~Ge~~~l~G~nGsGKSTLl~   49 (257)
T PRK10619         29 NAGDVISIIGSSGSGKSTFLR   49 (257)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 241
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=89.11  E-value=0.21  Score=49.38  Aligned_cols=21  Identities=38%  Similarity=0.707  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (258)
T PRK13548         26 RPGEVVAILGPNGAGKSTLLR   46 (258)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 242
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=89.10  E-value=0.2  Score=48.15  Aligned_cols=21  Identities=48%  Similarity=0.718  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        31 ~~Ge~~~l~G~nGsGKSTLlk   51 (226)
T cd03234          31 ESGQVMAILGSSGSGKTTLLD   51 (226)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            567899999999999999766


No 243
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.10  E-value=0.21  Score=49.63  Aligned_cols=21  Identities=33%  Similarity=0.387  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (271)
T PRK13638         25 SLSPVTGLVGANGCGKSTLFM   45 (271)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            458899999999999999765


No 244
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=89.09  E-value=0.21  Score=50.14  Aligned_cols=21  Identities=38%  Similarity=0.665  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||+|||||..
T Consensus        25 ~~Ge~~~l~G~nGsGKSTLl~   45 (272)
T PRK13547         25 EPGRVTALLGRNGAGKSTLLK   45 (272)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 245
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.07  E-value=0.21  Score=47.52  Aligned_cols=21  Identities=38%  Similarity=0.672  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (202)
T cd03233          31 KPGEMVLVLGRPGSGCSTLLK   51 (202)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 246
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=89.06  E-value=0.11  Score=48.30  Aligned_cols=13  Identities=38%  Similarity=0.938  Sum_probs=11.8

Q ss_pred             EeCCCCCcccccc
Q 011221          340 FGLSGTGKTTLST  352 (490)
Q Consensus       340 fGlSGtGKTTLs~  352 (490)
                      +|+||||||||+.
T Consensus         1 ~G~sGsGKSTla~   13 (163)
T PRK11545          1 MGVSGSGKSAVAS   13 (163)
T ss_pred             CCCCCCcHHHHHH
Confidence            5999999999876


No 247
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional
Probab=89.01  E-value=0.21  Score=49.52  Aligned_cols=21  Identities=33%  Similarity=0.703  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus        37 ~~Ge~~~i~G~NGsGKSTLl~   57 (267)
T PRK15112         37 REGQTLAIIGENGSGKSTLAK   57 (267)
T ss_pred             cCCCEEEEEcCCCCCHHHHHH
Confidence            568899999999999999765


No 248
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=89.00  E-value=0.21  Score=52.28  Aligned_cols=21  Identities=43%  Similarity=0.683  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||||||||..
T Consensus        26 ~~Ge~~~llGpsGsGKSTLLr   46 (353)
T PRK10851         26 PSGQMVALLGPSGSGKTTLLR   46 (353)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 249
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.00  E-value=0.22  Score=48.75  Aligned_cols=21  Identities=38%  Similarity=0.539  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        30 ~~Ge~~~i~G~nGsGKSTLl~   50 (253)
T PRK14261         30 PKNRVTALIGPSGCGKSTLLR   50 (253)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 250
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.
Probab=88.97  E-value=0.22  Score=49.33  Aligned_cols=21  Identities=38%  Similarity=0.703  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        35 ~~Ge~~~i~G~nGsGKSTLl~   55 (265)
T TIGR02769        35 EEGETVGLLGRSGCGKSTLAR   55 (265)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 251
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=88.97  E-value=0.36  Score=55.15  Aligned_cols=82  Identities=24%  Similarity=0.379  Sum_probs=46.2

Q ss_pred             EEEEEeCCCCCccccccc----CCCceeecCceee-------------------cCCCcc----ccCcceEEeecCCCCC
Q 011221          336 VALFFGLSGTGKTTLSTD----HNRYLIGDDEHCW-------------------GDNGVS----NIEGGCYAKCIDLSRE  388 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~~----~~~~lI~DD~~~w-------------------sd~Gvf----n~EgGcYaK~~dLs~e  388 (490)
                      +++|.|++|+|||+|+..    -+..++.=|..-+                   ++.|.+    .--+.+..-.+.+.+ 
T Consensus       486 ~~lf~Gp~GvGKT~lA~~la~~l~~~~~~~d~se~~~~~~~~~lig~~~gyvg~~~~~~l~~~~~~~p~~VvllDEiek-  564 (731)
T TIGR02639       486 SFLFTGPTGVGKTELAKQLAEALGVHLERFDMSEYMEKHTVSRLIGAPPGYVGFEQGGLLTEAVRKHPHCVLLLDEIEK-  564 (731)
T ss_pred             eEEEECCCCccHHHHHHHHHHHhcCCeEEEeCchhhhcccHHHHhcCCCCCcccchhhHHHHHHHhCCCeEEEEechhh-
Confidence            489999999999998761    1233332111111                   111111    112445666777764 


Q ss_pred             CCcchhhcccccceeee-eEEcCCCCeeecCCC
Q 011221          389 KEPDIWNAIKFGAVLEN-VVFDEHTREVDYSDK  420 (490)
Q Consensus       389 ~eP~I~~Ai~f~ailEN-V~lD~~~~~vdf~d~  420 (490)
                      ..|++++.+  -.++++ .+.|..++.+||.+.
T Consensus       565 a~~~~~~~L--l~~ld~g~~~d~~g~~vd~~~~  595 (731)
T TIGR02639       565 AHPDIYNIL--LQVMDYATLTDNNGRKADFRNV  595 (731)
T ss_pred             cCHHHHHHH--HHhhccCeeecCCCcccCCCCC
Confidence            567787764  234444 444666788888765


No 252
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.95  E-value=0.22  Score=48.63  Aligned_cols=21  Identities=29%  Similarity=0.526  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (251)
T PRK14270         28 YENKITALIGPSGCGKSTFLR   48 (251)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 253
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]
Probab=88.94  E-value=0.23  Score=48.26  Aligned_cols=21  Identities=33%  Similarity=0.702  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+++++.|+||+|||||..
T Consensus        26 ~~getlvllgpsgagkssllr   46 (242)
T COG4161          26 PEGETLVLLGPSGAGKSSLLR   46 (242)
T ss_pred             CCCCEEEEECCCCCchHHHHH
Confidence            579999999999999999765


No 254
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=88.94  E-value=0.22  Score=49.09  Aligned_cols=21  Identities=38%  Similarity=0.713  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (262)
T PRK09984         28 HHGEMVALLGPSGSGKSTLLR   48 (262)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 255
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional
Probab=88.94  E-value=0.22  Score=51.41  Aligned_cols=21  Identities=29%  Similarity=0.642  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+.|.|.||+|||||..
T Consensus        31 ~~Ge~~~ivG~sGsGKSTLl~   51 (330)
T PRK15093         31 TEGEIRGLVGESGSGKSLIAK   51 (330)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999766


No 256
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=88.93  E-value=0.21  Score=52.48  Aligned_cols=21  Identities=43%  Similarity=0.790  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||||||||..
T Consensus        27 ~~Ge~~~l~G~nGsGKSTLL~   47 (369)
T PRK11000         27 HEGEFVVFVGPSGCGKSTLLR   47 (369)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            468899999999999999765


No 257
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.
Probab=88.93  E-value=0.21  Score=54.10  Aligned_cols=21  Identities=38%  Similarity=0.597  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.+++.|+||+|||||..
T Consensus       359 ~~G~~vaIvG~SGsGKSTLl~  379 (529)
T TIGR02868       359 PPGERVAILGPSGSGKSTLLM  379 (529)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999776


No 258
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=88.91  E-value=0.21  Score=48.21  Aligned_cols=21  Identities=38%  Similarity=0.714  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~   49 (237)
T PRK11614         29 NQGEIVTLIGANGAGKTTLLG   49 (237)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 259
>PRK14237 phosphate transporter ATP-binding protein; Provisional
Probab=88.91  E-value=0.22  Score=49.41  Aligned_cols=21  Identities=29%  Similarity=0.544  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        44 ~~Ge~~~I~G~nGsGKSTLl~   64 (267)
T PRK14237         44 EKNKITALIGPSGSGKSTYLR   64 (267)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 260
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.86  E-value=0.23  Score=48.43  Aligned_cols=21  Identities=38%  Similarity=0.523  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (249)
T PRK14253         27 PARQVTALIGPSGCGKSTLLR   47 (249)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 261
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=88.85  E-value=0.22  Score=49.23  Aligned_cols=21  Identities=38%  Similarity=0.686  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~Ge~~~I~G~NGsGKSTLl~   48 (251)
T PRK09544         28 KPGKILTLLGPNGAGKSTLVR   48 (251)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 262
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.83  E-value=0.23  Score=48.39  Aligned_cols=21  Identities=43%  Similarity=0.632  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (252)
T PRK14272         28 QRGTVNALIGPSGCGKTTFLR   48 (252)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 263
>PRK14531 adenylate kinase; Provisional
Probab=88.80  E-value=0.18  Score=47.33  Aligned_cols=17  Identities=41%  Similarity=0.647  Sum_probs=15.6

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|++||||||++.
T Consensus         4 ~i~i~G~pGsGKsT~~~   20 (183)
T PRK14531          4 RLLFLGPPGAGKGTQAA   20 (183)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999877


No 264
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=88.79  E-value=0.22  Score=50.39  Aligned_cols=21  Identities=43%  Similarity=0.703  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.|.|++|+|||||..
T Consensus        17 ~~Ge~~~l~G~NGaGKSTLl~   37 (302)
T TIGR01188        17 REGEVFGFLGPNGAGKTTTIR   37 (302)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 265
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=88.79  E-value=0.19  Score=50.83  Aligned_cols=21  Identities=38%  Similarity=0.583  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..+.+++|.|++|+||||+.+
T Consensus       192 ~~~~vi~~vGptGvGKTTt~~  212 (282)
T TIGR03499       192 EQGGVIALVGPTGVGKTTTLA  212 (282)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            456799999999999999766


No 266
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional
Probab=88.77  E-value=0.23  Score=48.76  Aligned_cols=21  Identities=33%  Similarity=0.517  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus        27 ~~Ge~~~l~G~nGsGKSTLl~   47 (254)
T PRK10418         27 QRGRVLALVGGSGSGKSLTCA   47 (254)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 267
>KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism]
Probab=88.74  E-value=0.16  Score=54.23  Aligned_cols=35  Identities=37%  Similarity=0.638  Sum_probs=27.5

Q ss_pred             CCCEEEEEeCCCCCcccccccCCCceeecCceeec
Q 011221          333 DGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWG  367 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~~~~~~lI~DD~~~ws  367 (490)
                      .|-++-|.||||+||||+|...+++|+.-.+-+.+
T Consensus        49 rgctvw~tglsgagkttis~ale~~l~~~gipcy~   83 (627)
T KOG4238|consen   49 RGCTVWLTGLSGAGKTTISFALEEYLVSHGIPCYS   83 (627)
T ss_pred             cceeEEeeccCCCCcceeehHHHHHHHhcCCcccc
Confidence            45689999999999999999777777665555544


No 268
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit. This model describes the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits these transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L.lact
Probab=88.73  E-value=0.21  Score=52.62  Aligned_cols=21  Identities=38%  Similarity=0.743  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||||||||..
T Consensus        17 ~~Gei~~l~G~sGsGKSTLLr   37 (363)
T TIGR01186        17 AKGEIFVIMGLSGSGKSTTVR   37 (363)
T ss_pred             cCCCEEEEECCCCChHHHHHH
Confidence            568999999999999999765


No 269
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.71  E-value=0.23  Score=48.52  Aligned_cols=21  Identities=38%  Similarity=0.631  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|++|+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14245         27 EEKSVVAFIGPSGCGKSTFLR   47 (250)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999755


No 270
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=88.71  E-value=0.23  Score=48.13  Aligned_cols=21  Identities=43%  Similarity=0.781  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (248)
T PRK09580         25 RPGEVHAIMGPNGSGKSTLSA   45 (248)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 271
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=88.70  E-value=0.23  Score=49.38  Aligned_cols=21  Identities=43%  Similarity=0.893  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        48 ~~Ge~~~l~G~nGsGKSTLl~   68 (269)
T cd03294          48 REGEIFVIMGLSGSGKSTLLR   68 (269)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 272
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=88.69  E-value=0.24  Score=44.81  Aligned_cols=21  Identities=38%  Similarity=0.716  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+..+|.|++|+|||||..
T Consensus        23 ~~g~~~~i~G~nGsGKStll~   43 (157)
T cd00267          23 KAGEIVALVGPNGSGKSTLLR   43 (157)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 273
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.67  E-value=0.24  Score=48.33  Aligned_cols=21  Identities=29%  Similarity=0.569  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (251)
T PRK14251         28 EEKELTALIGPSGCGKSTFLR   48 (251)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 274
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]
Probab=88.66  E-value=0.079  Score=63.37  Aligned_cols=20  Identities=35%  Similarity=0.635  Sum_probs=17.2

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .|.++++.|+|||||||+-.
T Consensus      1015 ~GqTvALVG~SGsGKSTvI~ 1034 (1228)
T KOG0055|consen 1015 AGQTVALVGPSGSGKSTVIS 1034 (1228)
T ss_pred             CCCEEEEECCCCCCHHHHHH
Confidence            48899999999999999433


No 275
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=88.64  E-value=0.24  Score=49.05  Aligned_cols=21  Identities=38%  Similarity=0.626  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (265)
T PRK10253         31 PDGHFTAIIGPNGCGKSTLLR   51 (265)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 276
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein. This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter.
Probab=88.64  E-value=0.23  Score=51.67  Aligned_cols=21  Identities=48%  Similarity=0.650  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|+||+|||||..
T Consensus        21 ~~Gei~~l~G~nGsGKSTLl~   41 (354)
T TIGR02142        21 PGQGVTAIFGRSGSGKTTLIR   41 (354)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 277
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional
Probab=88.61  E-value=0.24  Score=49.27  Aligned_cols=21  Identities=43%  Similarity=0.751  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        36 ~~Ge~~~i~G~nGsGKSTLl~   56 (268)
T PRK10419         36 KSGETVALLGRSGCGKSTLAR   56 (268)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 278
>PRK00698 tmk thymidylate kinase; Validated
Probab=88.60  E-value=0.2  Score=46.68  Aligned_cols=19  Identities=32%  Similarity=0.459  Sum_probs=16.9

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      |..++|.|++|+||||++.
T Consensus         3 ~~~I~ieG~~gsGKsT~~~   21 (205)
T PRK00698          3 GMFITIEGIDGAGKSTQIE   21 (205)
T ss_pred             ceEEEEECCCCCCHHHHHH
Confidence            4579999999999999876


No 279
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=88.59  E-value=0.16  Score=43.91  Aligned_cols=17  Identities=35%  Similarity=0.726  Sum_probs=14.7

Q ss_pred             EEEEeCCCCCccccccc
Q 011221          337 ALFFGLSGTGKTTLSTD  353 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~~  353 (490)
                      +.|+|++|+|||+|+..
T Consensus         1 I~i~G~~G~GKS~l~~~   17 (107)
T PF00910_consen    1 IWIYGPPGIGKSTLAKE   17 (107)
T ss_pred             CEEECCCCCCHHHHHHH
Confidence            47999999999998773


No 280
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=88.59  E-value=0.24  Score=47.84  Aligned_cols=21  Identities=48%  Similarity=0.711  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (232)
T cd03300          24 KEGEFFTLLGPSGCGKTTLLR   44 (232)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            468999999999999999765


No 281
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.58  E-value=0.24  Score=48.35  Aligned_cols=21  Identities=38%  Similarity=0.588  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        29 ~~Ge~~~I~G~nGsGKSTLl~   49 (251)
T PRK14244         29 YKREVTAFIGPSGCGKSTFLR   49 (251)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            458899999999999999766


No 282
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein.
Probab=88.57  E-value=0.24  Score=48.11  Aligned_cols=21  Identities=38%  Similarity=0.656  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~   44 (237)
T TIGR00968        24 PTGSLVALLGPSGSGKSTLLR   44 (237)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999755


No 283
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=88.55  E-value=0.24  Score=50.26  Aligned_cols=21  Identities=29%  Similarity=0.569  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~Ge~~~l~G~NGaGKSTLl~   48 (303)
T TIGR01288        28 ARGECFGLLGPNGAGKSTIAR   48 (303)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 284
>PRK14235 phosphate transporter ATP-binding protein; Provisional
Probab=88.52  E-value=0.24  Score=49.10  Aligned_cols=21  Identities=38%  Similarity=0.602  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        43 ~~Ge~~~i~G~nGsGKSTLl~   63 (267)
T PRK14235         43 PEKTVTAFIGPSGCGKSTFLR   63 (267)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 285
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=88.51  E-value=0.25  Score=47.48  Aligned_cols=33  Identities=30%  Similarity=0.433  Sum_probs=21.5

Q ss_pred             CeeeeccccccCCCCCEEEEEeCCCCCcccccc
Q 011221          320 QILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       320 G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ++-++++...+.-+...++|.|++|+|||||..
T Consensus         8 nfr~~~~~~~l~~~~g~~~i~G~NGsGKTTLl~   40 (204)
T cd03240           8 NIRSFHERSEIEFFSPLTLIVGQNGAGKTTIIE   40 (204)
T ss_pred             CcccccCceEEecCCCeEEEECCCCCCHHHHHH
Confidence            344444443343222389999999999999654


No 286
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.50  E-value=0.25  Score=48.26  Aligned_cols=21  Identities=29%  Similarity=0.567  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|+||+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (246)
T PRK14269         26 EQNKITALIGASGCGKSTFLR   46 (246)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 287
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.50  E-value=0.24  Score=49.50  Aligned_cols=21  Identities=33%  Similarity=0.599  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.|+|+||+|||||..
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~   49 (274)
T PRK13647         29 PEGSKTALLGPNGAGKSTLLL   49 (274)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568999999999999999765


No 288
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=88.48  E-value=0.25  Score=49.27  Aligned_cols=21  Identities=33%  Similarity=0.571  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        48 ~~Ge~~~I~G~nGsGKSTLl~   68 (271)
T PRK14238         48 HENEVTAIIGPSGCGKSTYIK   68 (271)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 289
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.42  E-value=0.25  Score=48.63  Aligned_cols=21  Identities=33%  Similarity=0.525  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        36 ~~Ge~~~i~G~nGsGKSTLl~   56 (258)
T PRK14268         36 PKNSVTALIGPSGCGKSTFIR   56 (258)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            458899999999999999765


No 290
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=88.42  E-value=0.26  Score=46.78  Aligned_cols=21  Identities=43%  Similarity=0.798  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|.+|+|||||..
T Consensus        24 ~~Ge~~~i~G~nGsGKStLl~   44 (200)
T cd03217          24 KKGEVHALMGPNGSGKSTLAK   44 (200)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999655


No 291
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=88.36  E-value=0.25  Score=48.44  Aligned_cols=21  Identities=33%  Similarity=0.621  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus        26 ~~Ge~~~l~G~nGsGKSTLl~   46 (255)
T PRK11231         26 PTGKITALIGPNGCGKSTLLK   46 (255)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 292
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=88.35  E-value=0.26  Score=47.45  Aligned_cols=21  Identities=33%  Similarity=0.531  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~l~G~nGsGKSTLl~   45 (236)
T cd03253          25 PAGKKVAIVGPSGSGKSTILR   45 (236)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 293
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.33  E-value=0.26  Score=48.17  Aligned_cols=21  Identities=33%  Similarity=0.550  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        28 ~~G~~~~i~G~nGsGKSTLl~   48 (251)
T PRK14249         28 PERQITAIIGPSGCGKSTLLR   48 (251)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 294
>TIGR00455 apsK adenylylsulfate kinase (apsK). Important residue (active site in E.coli) is residue 100 of the seed alignment.
Probab=88.33  E-value=0.23  Score=46.19  Aligned_cols=21  Identities=43%  Similarity=0.711  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|+||+||||++.
T Consensus        16 ~~~~~i~i~G~~GsGKstla~   36 (184)
T TIGR00455        16 HRGVVIWLTGLSGSGKSTIAN   36 (184)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            456789999999999999876


No 295
>PRK14737 gmk guanylate kinase; Provisional
Probab=88.32  E-value=0.23  Score=47.44  Aligned_cols=20  Identities=20%  Similarity=0.393  Sum_probs=17.4

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+..++|.|+||+|||||..
T Consensus         3 ~~~~ivl~GpsG~GK~tl~~   22 (186)
T PRK14737          3 SPKLFIISSVAGGGKSTIIQ   22 (186)
T ss_pred             CCeEEEEECCCCCCHHHHHH
Confidence            35679999999999999876


No 296
>smart00072 GuKc Guanylate kinase homologues. Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.
Probab=88.32  E-value=0.24  Score=46.50  Aligned_cols=19  Identities=37%  Similarity=0.420  Sum_probs=17.0

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      ++.++++|+||+||+||..
T Consensus         2 ~r~ivl~Gpsg~GK~tl~~   20 (184)
T smart00072        2 RRPIVLSGPSGVGKGTLLA   20 (184)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            5679999999999999876


No 297
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.30  E-value=0.25  Score=49.68  Aligned_cols=21  Identities=33%  Similarity=0.578  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (286)
T PRK13646         31 EQGKYYAIVGQTGSGKSTLIQ   51 (286)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 298
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=88.27  E-value=0.26  Score=46.58  Aligned_cols=21  Identities=43%  Similarity=0.722  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus        33 ~~Ge~~~l~G~nGsGKStLl~   53 (194)
T cd03213          33 KPGELTAIMGPSGAGKSTLLN   53 (194)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 299
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]
Probab=88.27  E-value=0.17  Score=55.88  Aligned_cols=67  Identities=21%  Similarity=0.351  Sum_probs=40.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc------cCCC-ceeecCceeecCCCccccCcceEEeecCCCCCCCcchhhcccccceee
Q 011221          332 KDGDVALFFGLSGTGKTTLST------DHNR-YLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLE  404 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~------~~~~-~lI~DD~~~wsd~Gvfn~EgGcYaK~~dLs~e~eP~I~~Ai~f~ailE  404 (490)
                      .-|....+.|+||+|||||+.      .|.+ .+=-|      ...+..++.-.+.|-+++-+ ++-|+|    .|+|-|
T Consensus       360 ~~G~~lgIIGPSgSGKSTLaR~lvG~w~p~~G~VRLD------ga~l~qWd~e~lG~hiGYLP-QdVeLF----~GTIae  428 (580)
T COG4618         360 QAGEALGIIGPSGSGKSTLARLLVGIWPPTSGSVRLD------GADLRQWDREQLGRHIGYLP-QDVELF----DGTIAE  428 (580)
T ss_pred             cCCceEEEECCCCccHHHHHHHHHcccccCCCcEEec------chhhhcCCHHHhccccCcCc-ccceec----CCcHHH
Confidence            457899999999999999876      1211 11111      11123455556777777765 233333    368888


Q ss_pred             ee-EEc
Q 011221          405 NV-VFD  409 (490)
Q Consensus       405 NV-~lD  409 (490)
                      |+ .|+
T Consensus       429 NIaRf~  434 (580)
T COG4618         429 NIARFG  434 (580)
T ss_pred             HHHhcc
Confidence            84 454


No 300
>PRK14243 phosphate transporter ATP-binding protein; Provisional
Probab=88.26  E-value=0.26  Score=48.83  Aligned_cols=21  Identities=33%  Similarity=0.613  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        34 ~~Ge~~~i~G~nGsGKSTLl~   54 (264)
T PRK14243         34 PKNQITAFIGPSGCGKSTILR   54 (264)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 301
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=88.25  E-value=0.23  Score=42.02  Aligned_cols=16  Identities=44%  Similarity=0.632  Sum_probs=14.4

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++++|.+|+|||||..
T Consensus         2 I~V~G~~g~GKTsLi~   17 (119)
T PF08477_consen    2 IVVLGDSGVGKTSLIR   17 (119)
T ss_dssp             EEEECSTTSSHHHHHH
T ss_pred             EEEECcCCCCHHHHHH
Confidence            7899999999999765


No 302
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=88.22  E-value=0.24  Score=46.32  Aligned_cols=18  Identities=28%  Similarity=0.514  Sum_probs=16.2

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|.|++|||||||+.
T Consensus         5 ~~I~liG~~GaGKStl~~   22 (172)
T PRK05057          5 RNIFLVGPMGAGKSTIGR   22 (172)
T ss_pred             CEEEEECCCCcCHHHHHH
Confidence            469999999999999877


No 303
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=88.20  E-value=0.24  Score=46.89  Aligned_cols=20  Identities=40%  Similarity=0.815  Sum_probs=16.6

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      ++..++|+|++|||||.|+.
T Consensus        46 ~~~~l~l~G~~G~GKThLa~   65 (178)
T PF01695_consen   46 NGENLILYGPPGTGKTHLAV   65 (178)
T ss_dssp             C--EEEEEESTTSSHHHHHH
T ss_pred             cCeEEEEEhhHhHHHHHHHH
Confidence            46679999999999999877


No 304
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=88.19  E-value=0.25  Score=46.84  Aligned_cols=19  Identities=32%  Similarity=0.550  Sum_probs=17.1

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      +..++|+|++|||||+|+.
T Consensus        38 ~~~lll~G~~G~GKT~la~   56 (226)
T TIGR03420        38 DRFLYLWGESGSGKSHLLQ   56 (226)
T ss_pred             CCeEEEECCCCCCHHHHHH
Confidence            4679999999999999876


No 305
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein. This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Probab=88.17  E-value=0.26  Score=48.33  Aligned_cols=21  Identities=33%  Similarity=0.581  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        25 ~~Ge~~~i~G~nGsGKSTLl~   45 (256)
T TIGR03873        25 PPGSLTGLLGPNGSGKSTLLR   45 (256)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 306
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=88.14  E-value=0.23  Score=52.87  Aligned_cols=21  Identities=38%  Similarity=0.621  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.+++|+|++|+||||+.+
T Consensus       135 ~~g~ii~lvGptGvGKTTtia  155 (374)
T PRK14722        135 ERGGVFALMGPTGVGKTTTTA  155 (374)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            456799999999999999776


No 307
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=88.13  E-value=0.26  Score=51.19  Aligned_cols=21  Identities=38%  Similarity=0.580  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|+||+|||||..
T Consensus        29 ~~Gei~~iiG~nGsGKSTLlk   49 (343)
T PRK11153         29 PAGEIFGVIGASGAGKSTLIR   49 (343)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            568899999999999999766


No 308
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=88.10  E-value=0.25  Score=50.47  Aligned_cols=21  Identities=33%  Similarity=0.645  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|+||+|||||..
T Consensus        31 ~~Ge~v~iiG~nGsGKSTLl~   51 (305)
T PRK13651         31 NQGEFIAIIGQTGSGKTTFIE   51 (305)
T ss_pred             eCCCEEEEECCCCCcHHHHHH
Confidence            468999999999999999766


No 309
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=88.10  E-value=0.23  Score=46.92  Aligned_cols=17  Identities=47%  Similarity=0.583  Sum_probs=15.4

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      +++|.|+||+|||+|+.
T Consensus         5 ~~ll~GpsGvGKT~la~   21 (171)
T PF07724_consen    5 NFLLAGPSGVGKTELAK   21 (171)
T ss_dssp             EEEEESSTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999776


No 310
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=88.09  E-value=0.23  Score=42.77  Aligned_cols=16  Identities=44%  Similarity=0.646  Sum_probs=14.5

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++|+|++|+|||||..
T Consensus         2 i~i~G~~~~GKssl~~   17 (159)
T cd04159           2 ITLVGLQNSGKTTLVN   17 (159)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999866


No 311
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=88.05  E-value=0.26  Score=46.36  Aligned_cols=21  Identities=38%  Similarity=0.455  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..++|.|++|+|||||..
T Consensus        23 ~~g~~i~I~G~tGSGKTTll~   43 (186)
T cd01130          23 EARKNILISGGTGSGKTTLLN   43 (186)
T ss_pred             hCCCEEEEECCCCCCHHHHHH
Confidence            457789999999999999755


No 312
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.01  E-value=0.27  Score=49.33  Aligned_cols=21  Identities=33%  Similarity=0.635  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGaGKSTLl~   51 (279)
T PRK13635         31 YEGEWVAIVGHNGSGKSTLAK   51 (279)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            468899999999999999765


No 313
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.99  E-value=0.28  Score=47.81  Aligned_cols=21  Identities=33%  Similarity=0.525  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14266         27 PKNSVTALIGPSGCGKSTFIR   47 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 314
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.97  E-value=0.28  Score=48.51  Aligned_cols=21  Identities=33%  Similarity=0.556  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        40 ~~Ge~~~i~G~nGsGKSTLl~   60 (265)
T PRK14252         40 HEKQVTALIGPSGCGKSTFLR   60 (265)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 315
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional
Probab=87.97  E-value=0.26  Score=50.99  Aligned_cols=21  Identities=38%  Similarity=0.582  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|.||+|||||..
T Consensus        39 ~~Ge~~~IvG~sGsGKSTLl~   59 (327)
T PRK11308         39 ERGKTLAVVGESGCGKSTLAR   59 (327)
T ss_pred             CCCCEEEEECCCCCcHHHHHH
Confidence            568999999999999999766


No 316
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.95  E-value=0.27  Score=49.63  Aligned_cols=21  Identities=33%  Similarity=0.585  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (290)
T PRK13634         31 PSGSYVAIIGHTGSGKSTLLQ   51 (290)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            578999999999999999766


No 317
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Probab=87.95  E-value=0.27  Score=51.71  Aligned_cols=21  Identities=43%  Similarity=0.665  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|+|+||||||||..
T Consensus        29 ~~Ge~~~llGpsGsGKSTLLr   49 (362)
T TIGR03258        29 EAGELLALIGKSGCGKTTLLR   49 (362)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999655


No 318
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=87.95  E-value=0.26  Score=47.33  Aligned_cols=19  Identities=26%  Similarity=0.294  Sum_probs=17.0

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      |+.+++.|++|+|||||..
T Consensus        25 g~~~~ltGpNg~GKSTllr   43 (199)
T cd03283          25 KNGILITGSNMSGKSTFLR   43 (199)
T ss_pred             CcEEEEECCCCCChHHHHH
Confidence            5889999999999999754


No 319
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.95  E-value=0.28  Score=48.36  Aligned_cols=21  Identities=33%  Similarity=0.477  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~l~G~nGsGKSTLlk   51 (259)
T PRK14260         31 YRNKVTAIIGPSGCGKSTFIK   51 (259)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 320
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=87.93  E-value=0.27  Score=50.79  Aligned_cols=21  Identities=43%  Similarity=0.601  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|.||+|||||..
T Consensus        31 ~~Ge~~~lvG~sGsGKSTL~~   51 (326)
T PRK11022         31 KQGEVVGIVGESGSGKSVSSL   51 (326)
T ss_pred             CCCCEEEEECCCCChHHHHHH
Confidence            568899999999999999865


No 321
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=87.91  E-value=0.28  Score=48.13  Aligned_cols=21  Identities=33%  Similarity=0.675  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|++|+|||||..
T Consensus        20 ~~Gei~~l~G~nGsGKSTLl~   40 (248)
T PRK03695         20 RAGEILHLVGPNGAGKSTLLA   40 (248)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 322
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.90  E-value=0.28  Score=49.00  Aligned_cols=21  Identities=38%  Similarity=0.567  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        44 ~~Ge~~~IiG~nGsGKSTLl~   64 (274)
T PRK14265         44 PAKKIIAFIGPSGCGKSTLLR   64 (274)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 323
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.85  E-value=0.28  Score=49.38  Aligned_cols=21  Identities=33%  Similarity=0.404  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        63 ~~Ge~~~l~G~nGsGKSTLl~   83 (286)
T PRK14275         63 LSKYVTAIIGPSGCGKSTFLR   83 (286)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 324
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The DevBCA proteins are thought export of either heterocyst-specific glycolipids or an enzyme essential for formation of the laminated layer found in heterocysts.
Probab=87.84  E-value=0.29  Score=46.86  Aligned_cols=21  Identities=48%  Similarity=0.778  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus        29 ~~G~~~~I~G~nGsGKStLl~   49 (220)
T TIGR02982        29 NPGEIVILTGPSGSGKTTLLT   49 (220)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 325
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=87.79  E-value=0.28  Score=48.21  Aligned_cols=21  Identities=38%  Similarity=0.491  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|||||||+.
T Consensus        22 ~~g~~~~i~G~~G~GKTtl~~   42 (230)
T PRK08533         22 PAGSLILIEGDESTGKSILSQ   42 (230)
T ss_pred             CCCcEEEEECCCCCCHHHHHH
Confidence            446789999999999999864


No 326
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=87.77  E-value=0.2  Score=58.30  Aligned_cols=83  Identities=24%  Similarity=0.330  Sum_probs=46.3

Q ss_pred             EEEEEeCCCCCcccccccC-------CCceeecCceeecC-----------CCcccc-Cc-----------ceEEeecCC
Q 011221          336 VALFFGLSGTGKTTLSTDH-------NRYLIGDDEHCWGD-----------NGVSNI-EG-----------GCYAKCIDL  385 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~~~-------~~~lI~DD~~~wsd-----------~Gvfn~-Eg-----------GcYaK~~dL  385 (490)
                      +++|+|++|+|||.|+..-       +..++.=|+.-+.+           -|..+. |+           .+-.-.|++
T Consensus       598 ~~lf~Gp~GvGKT~lA~~La~~l~~~~~~~~~~dmse~~~~~~~~~l~g~~~gyvg~~~~g~L~~~v~~~p~svvllDEi  677 (852)
T TIGR03345       598 VFLLVGPSGVGKTETALALAELLYGGEQNLITINMSEFQEAHTVSRLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEV  677 (852)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHhCCCcceEEEeHHHhhhhhhhccccCCCCCcccccccchHHHHHHhCCCcEEEEech
Confidence            5899999999999987521       22333333222211           111111 22           234556666


Q ss_pred             CCCCCcchhhcccccceeeeeEEcCCCCeeecCCC
Q 011221          386 SREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDK  420 (490)
Q Consensus       386 s~e~eP~I~~Ai~f~ailENV~lD~~~~~vdf~d~  420 (490)
                      .+ ..|++++.+- ..+.+...-|..|+.|||.+.
T Consensus       678 ek-a~~~v~~~Ll-q~ld~g~l~d~~Gr~vd~~n~  710 (852)
T TIGR03345       678 EK-AHPDVLELFY-QVFDKGVMEDGEGREIDFKNT  710 (852)
T ss_pred             hh-cCHHHHHHHH-HHhhcceeecCCCcEEecccc
Confidence            53 5677776541 233344556778899999765


No 327
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.71  E-value=0.29  Score=49.31  Aligned_cols=21  Identities=33%  Similarity=0.555  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        63 ~~Ge~~~I~G~nGsGKSTLl~   83 (285)
T PRK14254         63 PENQVTAMIGPSGCGKSTFLR   83 (285)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 328
>PRK14532 adenylate kinase; Provisional
Probab=87.70  E-value=0.23  Score=46.25  Aligned_cols=17  Identities=29%  Similarity=0.491  Sum_probs=15.2

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|++||||||++.
T Consensus         2 ~i~~~G~pGsGKsT~a~   18 (188)
T PRK14532          2 NLILFGPPAAGKGTQAK   18 (188)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            37899999999999877


No 329
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=87.67  E-value=0.3  Score=48.72  Aligned_cols=21  Identities=33%  Similarity=0.550  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|+||+|||||..
T Consensus        24 ~~Ge~~~IvG~nGsGKSTLlk   44 (255)
T cd03236          24 REGQVLGLVGPNGIGKSTALK   44 (255)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 330
>TIGR01618 phage_P_loop phage nucleotide-binding protein. This model represents an uncharacterized family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of this protein is unknown.
Probab=87.64  E-value=0.39  Score=47.57  Aligned_cols=29  Identities=28%  Similarity=0.407  Sum_probs=21.0

Q ss_pred             cCCCCCEEEEEeCCCCCcccccc-cCCCce
Q 011221          330 MGKDGDVALFFGLSGTGKTTLST-DHNRYL  358 (490)
Q Consensus       330 i~~~g~~~lffGlSGtGKTTLs~-~~~~~l  358 (490)
                      +.+....++|.|++|+||||++. -+++.+
T Consensus         8 ~~~~~~~~liyG~~G~GKtt~a~~~~~~~~   37 (220)
T TIGR01618         8 IKRIPNMYLIYGKPGTGKTSTIKYLPGKTL   37 (220)
T ss_pred             cCCCCcEEEEECCCCCCHHHHHHhcCCCCE
Confidence            33334569999999999999886 344443


No 331
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=87.63  E-value=0.27  Score=44.14  Aligned_cols=18  Identities=39%  Similarity=0.578  Sum_probs=16.1

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++++|++|+|||||..
T Consensus        15 ~~v~i~G~~g~GKStLl~   32 (173)
T cd04155          15 PRILILGLDNAGKTTILK   32 (173)
T ss_pred             cEEEEEccCCCCHHHHHH
Confidence            469999999999999766


No 332
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.62  E-value=0.29  Score=49.05  Aligned_cols=21  Identities=33%  Similarity=0.548  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (279)
T PRK13650         31 KQGEWLSIIGHNGSGKSTTVR   51 (279)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 333
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=87.60  E-value=0.31  Score=47.77  Aligned_cols=38  Identities=26%  Similarity=0.390  Sum_probs=25.0

Q ss_pred             hcccCCeeeecccccc--C-CCCCEEEEEeCCCCCcccccc
Q 011221          315 LMPKRQILSLHSGCNM--G-KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       315 ~l~~~G~L~~H~sani--~-~~g~~~lffGlSGtGKTTLs~  352 (490)
                      .|++||.+-+.--.++  . +.|..+++-|+||+|||||..
T Consensus        15 tlH~q~Gi~LpV~~~vslsV~aGECvvL~G~SG~GKStllr   55 (235)
T COG4778          15 TLHQQGGVRLPVLRNVSLSVNAGECVVLHGPSGSGKSTLLR   55 (235)
T ss_pred             EeeecCCEEeeeeeceeEEecCccEEEeeCCCCCcHHHHHH
Confidence            3555554333212233  2 568899999999999999765


No 334
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=87.57  E-value=0.23  Score=45.82  Aligned_cols=16  Identities=38%  Similarity=0.638  Sum_probs=14.9

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++++|++||||||++.
T Consensus         2 I~i~G~pGsGKst~a~   17 (194)
T cd01428           2 ILLLGPPGSGKGTQAE   17 (194)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            7899999999999887


No 335
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.57  E-value=0.3  Score=49.05  Aligned_cols=21  Identities=33%  Similarity=0.613  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~I~G~nGaGKSTLl~   51 (282)
T PRK13640         31 PRGSWTALIGHNGSGKSTISK   51 (282)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            468899999999999999765


No 336
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]
Probab=87.56  E-value=0.3  Score=49.98  Aligned_cols=21  Identities=43%  Similarity=0.664  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.+..+.|.||||||||..
T Consensus        37 ~~ge~~glVGESG~GKSTlgr   57 (268)
T COG4608          37 KEGETLGLVGESGCGKSTLGR   57 (268)
T ss_pred             cCCCEEEEEecCCCCHHHHHH
Confidence            578999999999999999865


No 337
>PRK14236 phosphate transporter ATP-binding protein; Provisional
Probab=87.55  E-value=0.3  Score=48.59  Aligned_cols=21  Identities=43%  Similarity=0.618  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        49 ~~Ge~~~I~G~nGsGKSTLl~   69 (272)
T PRK14236         49 PKNRVTAFIGPSGCGKSTLLR   69 (272)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 338
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=87.55  E-value=0.23  Score=46.81  Aligned_cols=16  Identities=44%  Similarity=0.563  Sum_probs=14.8

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      +++.|.||||||||+.
T Consensus         2 i~i~G~sgsGKttla~   17 (179)
T cd02028           2 VGIAGPSGSGKTTFAK   17 (179)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6889999999999987


No 339
>PRK08356 hypothetical protein; Provisional
Probab=87.53  E-value=0.28  Score=46.38  Aligned_cols=20  Identities=25%  Similarity=0.322  Sum_probs=16.6

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      +...++|+|++|+||||++.
T Consensus         4 ~~~~i~~~G~~gsGK~t~a~   23 (195)
T PRK08356          4 EKMIVGVVGKIAAGKTTVAK   23 (195)
T ss_pred             CcEEEEEECCCCCCHHHHHH
Confidence            33468899999999999766


No 340
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.50  E-value=0.3  Score=48.75  Aligned_cols=21  Identities=33%  Similarity=0.661  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Ge~~~l~G~nGsGKSTLl~   46 (275)
T PRK13639         26 EKGEMVALLGPNGAGKSTLFL   46 (275)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 341
>PRK02496 adk adenylate kinase; Provisional
Probab=87.50  E-value=0.24  Score=46.06  Aligned_cols=17  Identities=35%  Similarity=0.612  Sum_probs=15.3

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|++|+||||++.
T Consensus         3 ~i~i~G~pGsGKst~a~   19 (184)
T PRK02496          3 RLIFLGPPGAGKGTQAV   19 (184)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999877


No 342
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria.
Probab=87.47  E-value=0.3  Score=51.12  Aligned_cols=21  Identities=38%  Similarity=0.553  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|+||||||||..
T Consensus        29 ~~Gei~gIiG~sGaGKSTLlr   49 (343)
T TIGR02314        29 PAGQIYGVIGASGAGKSTLIR   49 (343)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 343
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.46  E-value=0.31  Score=48.85  Aligned_cols=21  Identities=33%  Similarity=0.504  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        45 ~~Ge~~~I~G~nGsGKSTLl~   65 (276)
T PRK14271         45 PARAVTSLMGPTGSGKTTFLR   65 (276)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 344
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional
Probab=87.44  E-value=0.28  Score=50.75  Aligned_cols=21  Identities=29%  Similarity=0.480  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.|.|.||+|||||..
T Consensus        40 ~~Ge~~~ivG~sGsGKSTL~~   60 (330)
T PRK09473         40 RAGETLGIVGESGSGKSQTAF   60 (330)
T ss_pred             cCCCEEEEECCCCchHHHHHH
Confidence            568999999999999999766


No 345
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=87.43  E-value=0.29  Score=49.45  Aligned_cols=21  Identities=33%  Similarity=0.510  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      .-|..+++.|.||+|||||..
T Consensus        19 p~g~~~~vtGvSGsGKStL~~   39 (261)
T cd03271          19 PLGVLTCVTGVSGSGKSSLIN   39 (261)
T ss_pred             cCCcEEEEECCCCCchHHHHH
Confidence            458889999999999999876


No 346
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=87.41  E-value=0.31  Score=46.81  Aligned_cols=20  Identities=30%  Similarity=0.566  Sum_probs=17.2

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      +|..++|.|++|+|||||..
T Consensus        27 ~~~~~~i~G~NGsGKSTll~   46 (213)
T cd03279          27 NNGLFLICGPTGAGKSTILD   46 (213)
T ss_pred             ccCEEEEECCCCCCHHHHHH
Confidence            36789999999999999654


No 347
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.35  E-value=0.3  Score=49.10  Aligned_cols=21  Identities=33%  Similarity=0.680  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~iiG~NGaGKSTLl~   51 (287)
T PRK13641         31 EEGSFVALVGHTGSGKSTLMQ   51 (287)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 348
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.35  E-value=0.31  Score=49.15  Aligned_cols=21  Identities=38%  Similarity=0.703  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        31 ~~Ge~~~i~G~nGaGKSTLl~   51 (287)
T PRK13637         31 EDGEFVGLIGHTGSGKSTLIQ   51 (287)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            468899999999999999765


No 349
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.34  E-value=0.31  Score=48.67  Aligned_cols=21  Identities=29%  Similarity=0.387  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus        28 ~~Ge~~~i~G~NGsGKSTLl~   48 (277)
T PRK13652         28 PRNSRIAVIGPNGAGKSTLFR   48 (277)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 350
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=87.34  E-value=0.25  Score=43.25  Aligned_cols=16  Identities=31%  Similarity=0.517  Sum_probs=14.7

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++|.|++||||||++.
T Consensus         2 I~i~G~~GsGKst~a~   17 (147)
T cd02020           2 IAIDGPAGSGKSTVAK   17 (147)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6899999999999877


No 351
>PHA00729 NTP-binding motif containing protein
Probab=87.30  E-value=0.25  Score=49.30  Aligned_cols=17  Identities=47%  Similarity=0.757  Sum_probs=16.1

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|.+|||||||+.
T Consensus        19 nIlItG~pGvGKT~LA~   35 (226)
T PHA00729         19 SAVIFGKQGSGKTTYAL   35 (226)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            59999999999999988


No 352
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]
Probab=87.30  E-value=0.26  Score=49.16  Aligned_cols=21  Identities=38%  Similarity=0.713  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+|.++.++|+.|+||||+..
T Consensus        26 e~Gei~GlLG~NGAGKTT~LR   46 (245)
T COG4555          26 EEGEITGLLGENGAGKTTLLR   46 (245)
T ss_pred             ccceEEEEEcCCCCCchhHHH
Confidence            579999999999999999654


No 353
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=87.28  E-value=0.3  Score=49.75  Aligned_cols=21  Identities=38%  Similarity=0.626  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..++|.|++|+|||||..
T Consensus        29 ~~Gei~gllG~NGAGKTTllk   49 (293)
T COG1131          29 EPGEIFGLLGPNGAGKTTLLK   49 (293)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            568899999999999999655


No 354
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=87.23  E-value=0.24  Score=48.45  Aligned_cols=16  Identities=25%  Similarity=0.229  Sum_probs=14.3

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      +.|.|.||||||||+.
T Consensus         2 igI~G~sGSGKTTla~   17 (220)
T cd02025           2 IGIAGSVAVGKSTTAR   17 (220)
T ss_pred             EEeeCCCCCCHHHHHH
Confidence            5788999999999876


No 355
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=87.22  E-value=0.32  Score=48.67  Aligned_cols=21  Identities=33%  Similarity=0.760  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|+|++|+|||||..
T Consensus        34 ~~Ge~~~l~G~nGsGKSTLl~   54 (280)
T PRK13633         34 KKGEFLVILGRNGSGKSTIAK   54 (280)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 356
>PRK08084 DNA replication initiation factor; Provisional
Probab=87.20  E-value=0.28  Score=48.15  Aligned_cols=18  Identities=17%  Similarity=0.399  Sum_probs=16.2

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|+|++|||||+|+.
T Consensus        46 ~~l~l~Gp~G~GKThLl~   63 (235)
T PRK08084         46 GYIYLWSREGAGRSHLLH   63 (235)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            478999999999999876


No 357
>PRK06893 DNA replication initiation factor; Validated
Probab=87.19  E-value=0.24  Score=48.41  Aligned_cols=18  Identities=22%  Similarity=0.351  Sum_probs=16.0

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|+|++|||||+|+.
T Consensus        40 ~~l~l~G~~G~GKThL~~   57 (229)
T PRK06893         40 PFFYIWGGKSSGKSHLLK   57 (229)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            458999999999999877


No 358
>CHL00095 clpC Clp protease ATP binding subunit
Probab=87.17  E-value=0.59  Score=54.19  Aligned_cols=17  Identities=47%  Similarity=0.688  Sum_probs=15.3

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      +.+|.|++|+|||+|+.
T Consensus       541 ~~lf~Gp~GvGKt~lA~  557 (821)
T CHL00095        541 SFLFSGPTGVGKTELTK  557 (821)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            47899999999999876


No 359
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional
Probab=87.13  E-value=0.32  Score=50.41  Aligned_cols=21  Identities=33%  Similarity=0.529  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|.||+|||||..
T Consensus        45 ~~Ge~~~lvG~sGsGKSTLlk   65 (331)
T PRK15079         45 YEGETLGVVGESGCGKSTFAR   65 (331)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999766


No 360
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=87.11  E-value=0.36  Score=46.69  Aligned_cols=20  Identities=20%  Similarity=0.403  Sum_probs=16.8

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      ++...+|.|++|+|||||..
T Consensus        22 ~~~~~~i~GpNGsGKStll~   41 (243)
T cd03272          22 SPKHNVVVGRNGSGKSNFFA   41 (243)
T ss_pred             CCCcEEEECCCCCCHHHHHH
Confidence            46689999999999999643


No 361
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=86.98  E-value=0.33  Score=48.51  Aligned_cols=21  Identities=38%  Similarity=0.632  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~   46 (274)
T PRK13644         26 KKGEYIGIIGKNGSGKSTLAL   46 (274)
T ss_pred             eCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 362
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=86.94  E-value=0.33  Score=53.13  Aligned_cols=21  Identities=33%  Similarity=0.637  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|.||+|||||..
T Consensus       367 ~~G~~~aIvG~sGsGKSTLl~  387 (582)
T PRK11176        367 PAGKTVALVGRSGSGKSTIAN  387 (582)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 363
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=86.92  E-value=0.29  Score=46.21  Aligned_cols=21  Identities=29%  Similarity=0.692  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.++|++|||||+++.
T Consensus        10 ~~g~i~~i~G~~GsGKT~l~~   30 (209)
T TIGR02237        10 ERGTITQIYGPPGSGKTNICM   30 (209)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            347789999999999999876


No 364
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).
Probab=86.89  E-value=0.27  Score=44.97  Aligned_cols=17  Identities=47%  Similarity=0.749  Sum_probs=15.3

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|.|+.|+||||++.
T Consensus         2 ~I~ieG~~GsGKtT~~~   18 (200)
T cd01672           2 FIVFEGIDGAGKTTLIE   18 (200)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999877


No 365
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=86.89  E-value=0.35  Score=46.94  Aligned_cols=21  Identities=33%  Similarity=0.645  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        23 ~~Ge~~~i~G~nG~GKStLl~   43 (235)
T cd03299          23 ERGDYFVILGPTGSGKSVLLE   43 (235)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999655


No 366
>PRK06526 transposase; Provisional
Probab=86.85  E-value=0.29  Score=49.09  Aligned_cols=20  Identities=40%  Similarity=0.679  Sum_probs=17.6

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+..++|.|++|||||+|+.
T Consensus        97 ~~~nlll~Gp~GtGKThLa~  116 (254)
T PRK06526         97 GKENVVFLGPPGTGKTHLAI  116 (254)
T ss_pred             cCceEEEEeCCCCchHHHHH
Confidence            45679999999999999877


No 367
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=86.85  E-value=0.29  Score=48.98  Aligned_cols=18  Identities=50%  Similarity=0.781  Sum_probs=16.1

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|+|++|||||+|+.
T Consensus        31 ~~~ll~Gp~G~GKT~la~   48 (305)
T TIGR00635        31 DHLLLYGPPGLGKTTLAH   48 (305)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            468999999999999876


No 368
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=86.84  E-value=0.35  Score=48.38  Aligned_cols=21  Identities=29%  Similarity=0.552  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus        31 ~~Ge~~~I~G~nGsGKSTLl~   51 (277)
T PRK13642         31 TKGEWVSIIGQNGSGKSTTAR   51 (277)
T ss_pred             cCCCEEEEECCCCCcHHHHHH
Confidence            468899999999999999765


No 369
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=86.82  E-value=0.35  Score=48.57  Aligned_cols=21  Identities=43%  Similarity=0.700  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        30 ~~Ge~~~i~G~nGaGKSTLl~   50 (283)
T PRK13636         30 KKGEVTAILGGNGAGKSTLFQ   50 (283)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 370
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=86.77  E-value=0.35  Score=49.88  Aligned_cols=21  Identities=38%  Similarity=0.646  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||||||||..
T Consensus        50 ~~Ge~~~I~G~nGsGKSTLl~   70 (320)
T PRK13631         50 EKNKIYFIIGNSGSGKSTLVT   70 (320)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 371
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=86.74  E-value=0.33  Score=41.11  Aligned_cols=17  Identities=29%  Similarity=0.393  Sum_probs=15.3

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .+++.|.+|+|||||..
T Consensus         3 ki~~~G~~~~GKstl~~   19 (161)
T TIGR00231         3 KIVIVGDPNVGKSTLLN   19 (161)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999766


No 372
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=86.72  E-value=0.46  Score=51.15  Aligned_cols=43  Identities=16%  Similarity=0.338  Sum_probs=27.6

Q ss_pred             hhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCcccccc
Q 011221          303 EMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       303 EmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +++..++.++.      ..+++..+..+ ..+..++|.|++|+||||+.+
T Consensus       182 ~v~~~~~~~L~------~~l~~~~~~~~-~~~~ii~lvGptGvGKTTt~a  224 (407)
T PRK12726        182 DITDWFVPYLS------GKLAVEDSFDL-SNHRIISLIGQTGVGKTTTLV  224 (407)
T ss_pred             HHHHHHHHHhc------CcEeeCCCcee-cCCeEEEEECCCCCCHHHHHH
Confidence            34444444443      34444443322 357889999999999999776


No 373
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=86.68  E-value=0.31  Score=44.42  Aligned_cols=23  Identities=22%  Similarity=0.514  Sum_probs=17.0

Q ss_pred             cCCCCCEEEEEeCCCCCcccccc
Q 011221          330 MGKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       330 i~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.-+....+|+|++||||||+..
T Consensus        15 i~f~~g~~vi~G~Ng~GKStil~   37 (202)
T PF13476_consen   15 IDFSPGLNVIYGPNGSGKSTILE   37 (202)
T ss_dssp             EE--SEEEEEEESTTSSHHHHHH
T ss_pred             EEcCCCcEEEECCCCCCHHHHHH
Confidence            33344589999999999999654


No 374
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=86.67  E-value=0.31  Score=46.46  Aligned_cols=20  Identities=40%  Similarity=0.730  Sum_probs=17.8

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .|..++++|.+|+|||||+.
T Consensus        18 ~g~i~~i~G~~GsGKT~l~~   37 (218)
T cd01394          18 RGTVTQVYGPPGTGKTNIAI   37 (218)
T ss_pred             CCeEEEEECCCCCCHHHHHH
Confidence            46789999999999999866


No 375
>PF05729 NACHT:  NACHT domain
Probab=86.67  E-value=0.31  Score=43.00  Aligned_cols=18  Identities=39%  Similarity=0.505  Sum_probs=15.9

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      +++++.|..|+||||+..
T Consensus         1 r~l~I~G~~G~GKStll~   18 (166)
T PF05729_consen    1 RVLWISGEPGSGKSTLLR   18 (166)
T ss_pred             CEEEEECCCCCChHHHHH
Confidence            468999999999999776


No 376
>PHA02530 pseT polynucleotide kinase; Provisional
Probab=86.66  E-value=0.28  Score=48.95  Aligned_cols=17  Identities=35%  Similarity=0.688  Sum_probs=15.4

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|.|++||||||++.
T Consensus         4 liil~G~pGSGKSTla~   20 (300)
T PHA02530          4 IILTVGVPGSGKSTWAR   20 (300)
T ss_pred             EEEEEcCCCCCHHHHHH
Confidence            57889999999999887


No 377
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=86.65  E-value=0.32  Score=46.31  Aligned_cols=18  Identities=50%  Similarity=0.752  Sum_probs=16.7

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      +.+++.|++|+|||||..
T Consensus        24 e~~~i~G~nGsGKSTLl~   41 (214)
T cd03297          24 EVTGIFGASGAGKSTLLR   41 (214)
T ss_pred             eeEEEECCCCCCHHHHHH
Confidence            889999999999999766


No 378
>PRK01184 hypothetical protein; Provisional
Probab=86.55  E-value=0.31  Score=45.20  Aligned_cols=17  Identities=29%  Similarity=0.567  Sum_probs=14.9

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .+++.|++||||||++.
T Consensus         3 ~i~l~G~~GsGKsT~a~   19 (184)
T PRK01184          3 IIGVVGMPGSGKGEFSK   19 (184)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999755


No 379
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional
Probab=86.53  E-value=0.37  Score=48.21  Aligned_cols=21  Identities=48%  Similarity=0.811  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        48 ~~Ge~~~liG~NGsGKSTLlk   68 (264)
T PRK13546         48 YEGDVIGLVGINGSGKSTLSN   68 (264)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            578999999999999999766


No 380
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=86.52  E-value=0.38  Score=47.42  Aligned_cols=21  Identities=38%  Similarity=0.570  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.++++|.+|+|||||..
T Consensus        45 ~~Ge~~~i~G~nGsGKSTLl~   65 (257)
T cd03288          45 KPGQKVGICGRTGSGKSSLSL   65 (257)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 381
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.49  E-value=0.38  Score=47.55  Aligned_cols=21  Identities=33%  Similarity=0.491  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|.+|+|||||..
T Consensus        31 ~~Ge~~~I~G~nGsGKSTLl~   51 (261)
T PRK14258         31 YQSKVTAIIGPSGCGKSTFLK   51 (261)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 382
>PRK06620 hypothetical protein; Validated
Probab=86.47  E-value=0.3  Score=47.64  Aligned_cols=18  Identities=39%  Similarity=0.379  Sum_probs=16.3

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|+|++|+|||+|..
T Consensus        45 ~~l~l~Gp~G~GKThLl~   62 (214)
T PRK06620         45 FTLLIKGPSSSGKTYLTK   62 (214)
T ss_pred             ceEEEECCCCCCHHHHHH
Confidence            569999999999999876


No 383
>PRK12339 2-phosphoglycerate kinase; Provisional
Probab=86.46  E-value=0.32  Score=47.02  Aligned_cols=19  Identities=32%  Similarity=0.607  Sum_probs=16.8

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      +..+++.|+||+||||++.
T Consensus         3 ~~~i~i~G~~G~GKst~a~   21 (197)
T PRK12339          3 STIHFIGGIPGVGKTSISG   21 (197)
T ss_pred             ceEEEEECCCCCCHHHHHH
Confidence            4578999999999999887


No 384
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=86.46  E-value=0.36  Score=48.67  Aligned_cols=21  Identities=38%  Similarity=0.669  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus        30 ~~Ge~v~i~G~nGsGKSTLl~   50 (288)
T PRK13643         30 KKGSYTALIGHTGSGKSTLLQ   50 (288)
T ss_pred             cCCCEEEEECCCCChHHHHHH
Confidence            568899999999999999766


No 385
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=86.42  E-value=0.38  Score=48.92  Aligned_cols=21  Identities=33%  Similarity=0.645  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.+.|+.|||||||..
T Consensus        26 ~~G~i~~iiGpNG~GKSTLLk   46 (258)
T COG1120          26 PKGEITGILGPNGSGKSTLLK   46 (258)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 386
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=86.42  E-value=0.33  Score=43.22  Aligned_cols=16  Identities=44%  Similarity=0.704  Sum_probs=14.5

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++|+|++|+|||||..
T Consensus         2 i~~vG~~~~GKstLi~   17 (167)
T cd04160           2 VLILGLDNAGKTTFLE   17 (167)
T ss_pred             EEEEecCCCCHHHHHH
Confidence            6899999999999766


No 387
>PRK13947 shikimate kinase; Provisional
Probab=86.40  E-value=0.3  Score=44.48  Aligned_cols=28  Identities=32%  Similarity=0.462  Sum_probs=20.3

Q ss_pred             EEEEEeCCCCCccccccc----CCCceeecCc
Q 011221          336 VALFFGLSGTGKTTLSTD----HNRYLIGDDE  363 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~~----~~~~lI~DD~  363 (490)
                      .+++.|++||||||++..    -+..+|..|.
T Consensus         3 ~I~l~G~~GsGKst~a~~La~~lg~~~id~d~   34 (171)
T PRK13947          3 NIVLIGFMGTGKTTVGKRVATTLSFGFIDTDK   34 (171)
T ss_pred             eEEEEcCCCCCHHHHHHHHHHHhCCCEEECch
Confidence            489999999999998762    2444565444


No 388
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional
Probab=86.37  E-value=0.39  Score=47.59  Aligned_cols=21  Identities=33%  Similarity=0.507  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        34 ~~Ge~~~i~G~nGsGKSTLl~   54 (257)
T PRK14246         34 PNNSIFGIMGPSGSGKSTLLK   54 (257)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 389
>PRK13975 thymidylate kinase; Provisional
Probab=86.36  E-value=0.33  Score=45.19  Aligned_cols=18  Identities=39%  Similarity=0.687  Sum_probs=16.3

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|.|+.|+||||++.
T Consensus         3 ~~I~ieG~~GsGKtT~~~   20 (196)
T PRK13975          3 KFIVFEGIDGSGKTTQAK   20 (196)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            468999999999999877


No 390
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=86.21  E-value=0.38  Score=51.76  Aligned_cols=21  Identities=38%  Similarity=0.703  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        27 ~~Ge~~~liG~nGsGKSTLl~   47 (490)
T PRK10938         27 NAGDSWAFVGANGSGKSALAR   47 (490)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 391
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.
Probab=86.15  E-value=0.3  Score=47.03  Aligned_cols=16  Identities=38%  Similarity=0.536  Sum_probs=14.6

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      +++.|.||||||||+.
T Consensus         2 i~i~G~sgsGKTtla~   17 (187)
T cd02024           2 VGISGVTNSGKTTLAK   17 (187)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            6789999999999887


No 392
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=86.04  E-value=0.38  Score=46.08  Aligned_cols=18  Identities=28%  Similarity=0.649  Sum_probs=15.8

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      | .++|+|+||+|||||..
T Consensus        23 g-~~~i~G~nGsGKStll~   40 (197)
T cd03278          23 G-LTAIVGPNGSGKSNIID   40 (197)
T ss_pred             C-cEEEECCCCCCHHHHHH
Confidence            5 88999999999999654


No 393
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=86.04  E-value=0.37  Score=46.29  Aligned_cols=19  Identities=21%  Similarity=0.503  Sum_probs=17.0

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      +..++|+|.+|||||+|+.
T Consensus        42 ~~~~~l~G~~G~GKT~La~   60 (227)
T PRK08903         42 DRFFYLWGEAGSGRSHLLQ   60 (227)
T ss_pred             CCeEEEECCCCCCHHHHHH
Confidence            4579999999999999876


No 394
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=86.02  E-value=0.39  Score=52.09  Aligned_cols=21  Identities=38%  Similarity=0.658  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||||||||..
T Consensus        24 ~~Ge~~~iiG~nGsGKSTLl~   44 (520)
T TIGR03269        24 EEGEVLGILGRSGAGKSVLMH   44 (520)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 395
>TIGR01351 adk adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.
Probab=85.96  E-value=0.32  Score=46.49  Aligned_cols=16  Identities=31%  Similarity=0.588  Sum_probs=14.8

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++++|++|+||||++.
T Consensus         2 I~i~G~pGsGKsT~a~   17 (210)
T TIGR01351         2 LVLLGPPGSGKGTQAK   17 (210)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            7899999999999877


No 396
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=85.93  E-value=0.38  Score=46.38  Aligned_cols=19  Identities=42%  Similarity=0.609  Sum_probs=14.3

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      ..+++|.||||+|||+|-.
T Consensus         3 ~~~vlL~Gps~SGKTaLf~   21 (181)
T PF09439_consen    3 RPTVLLVGPSGSGKTALFS   21 (181)
T ss_dssp             --EEEEE-STTSSHHHHHH
T ss_pred             CceEEEEcCCCCCHHHHHH
Confidence            4579999999999999654


No 397
>PRK13537 nodulation ABC transporter NodI; Provisional
Probab=85.90  E-value=0.4  Score=48.95  Aligned_cols=21  Identities=33%  Similarity=0.499  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.|.|++|||||||..
T Consensus        31 ~~Gei~gllGpNGaGKSTLl~   51 (306)
T PRK13537         31 QRGECFGLLGPNGAGKTTTLR   51 (306)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999655


No 398
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=85.85  E-value=0.39  Score=41.49  Aligned_cols=18  Identities=28%  Similarity=0.401  Sum_probs=15.9

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|+|.+|+|||||..
T Consensus         4 ~~i~~~G~~g~GKttl~~   21 (168)
T cd04163           4 GFVAIVGRPNVGKSTLLN   21 (168)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            468999999999999776


No 399
>PF00625 Guanylate_kin:  Guanylate kinase;  InterPro: IPR008144 Guanylate kinase (2.7.4.8 from EC) (GK) [] catalyzes the ATP-dependent phosphorylation of GMP into GDP. It is essential for recycling GMP and indirectly, cGMP. In prokaryotes (such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids. GK has been shown [, , ] to be structurally similar to protein A57R (or SalG2R) from various strains of Vaccinia virus. Proteins containing one or more copies of the DHR domain, an SH3 domain as well as a C-terminal GK-like domain, are collectively termed MAGUKs (membrane-associated guanylate kinase homologs) [], and include Drosophila lethal(1)discs large-1 tumor suppressor protein (gene dlg1); mammalian tight junction protein Zo-1; a family of mammalian synaptic proteins that seem to interact with the cytoplasmic tail of NMDA receptor subunits (SAP90/PSD-95, CHAPSYN-110/PSD-93, SAP97/DLG1 and SAP102); vertebrate 55kDa erythrocyte membrane protein (p55); Caenorhabditis elegans protein lin-2; rat protein CASK; and human proteins DLG2 and DLG3. There is an ATP-binding site (P-loop) in the N-terminal section of GK, which is not conserved in the GK-like domain of the above proteins. However these proteins retain the residues known, in GK, to be involved in the binding of GMP.; GO: 0005515 protein binding; PDB: 3UAT_A 3KFV_A 2ANC_F 2F3T_E 2ANB_A 2AN9_A 1S96_A 2F3R_B 3TR0_A 1LVG_A ....
Probab=85.85  E-value=0.39  Score=44.82  Aligned_cols=19  Identities=37%  Similarity=0.590  Sum_probs=17.0

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      ++.++|.|+||+|||||..
T Consensus         2 ~r~ivl~Gpsg~GK~~l~~   20 (183)
T PF00625_consen    2 RRPIVLVGPSGSGKSTLAK   20 (183)
T ss_dssp             SSEEEEESSTTSSHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            5789999999999999866


No 400
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=85.82  E-value=0.47  Score=52.00  Aligned_cols=21  Identities=38%  Similarity=0.616  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|+||+|||||..
T Consensus       353 ~~Ge~vaiVG~sGsGKSTl~~  373 (567)
T COG1132         353 EPGEKVAIVGPSGSGKSTLIK  373 (567)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999776


No 401
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=85.80  E-value=0.39  Score=51.93  Aligned_cols=21  Identities=33%  Similarity=0.545  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        28 ~~Ge~~~l~G~NGsGKSTLl~   48 (501)
T PRK10762         28 YPGRVMALVGENGAGKSTMMK   48 (501)
T ss_pred             cCCeEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 402
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional
Probab=85.78  E-value=0.41  Score=52.68  Aligned_cols=21  Identities=38%  Similarity=0.627  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.+++.|.||+|||||..
T Consensus       359 ~~G~~v~IvG~sGsGKSTLl~  379 (588)
T PRK13657        359 KPGQTVAIVGPTGAGKSTLIN  379 (588)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 403
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=85.76  E-value=0.35  Score=46.18  Aligned_cols=17  Identities=35%  Similarity=0.563  Sum_probs=14.9

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|.|++|+||||+..
T Consensus         3 lilI~GptGSGKTTll~   19 (198)
T cd01131           3 LVLVTGPTGSGKSTTLA   19 (198)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999655


No 404
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional
Probab=85.73  E-value=0.43  Score=47.37  Aligned_cols=21  Identities=33%  Similarity=0.627  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        32 ~~Ge~~~i~G~nGsGKSTLl~   52 (261)
T PRK14263         32 RKNEITGFIGPSGCGKSTVLR   52 (261)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 405
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=85.72  E-value=0.36  Score=42.09  Aligned_cols=16  Identities=25%  Similarity=0.667  Sum_probs=14.5

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++|+|++|+|||||..
T Consensus         2 i~i~G~~~~GKTsli~   17 (160)
T cd00876           2 VVVLGAGGVGKSAITI   17 (160)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            7899999999999765


No 406
>PRK04040 adenylate kinase; Provisional
Probab=85.70  E-value=0.38  Score=45.97  Aligned_cols=18  Identities=39%  Similarity=0.632  Sum_probs=16.0

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..+++.|.+|+||||++.
T Consensus         3 ~~i~v~G~pG~GKtt~~~   20 (188)
T PRK04040          3 KVVVVTGVPGVGKTTVLN   20 (188)
T ss_pred             eEEEEEeCCCCCHHHHHH
Confidence            368999999999999877


No 407
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional
Probab=85.69  E-value=0.43  Score=48.54  Aligned_cols=21  Identities=33%  Similarity=0.531  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        69 ~~Ge~~~IvG~nGsGKSTLl~   89 (305)
T PRK14264         69 PEKSVTALIGPSGCGKSTFLR   89 (305)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999765


No 408
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=85.63  E-value=0.37  Score=42.56  Aligned_cols=16  Identities=44%  Similarity=0.708  Sum_probs=14.5

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++|+|++|+|||||..
T Consensus         2 i~i~G~~~~GKTsl~~   17 (160)
T cd04156           2 VLLLGLDSAGKSTLLY   17 (160)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999866


No 409
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=85.59  E-value=0.42  Score=51.77  Aligned_cols=21  Identities=33%  Similarity=0.635  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        29 ~~Ge~~~liG~nGsGKSTLl~   49 (510)
T PRK09700         29 YPGEIHALLGENGAGKSTLMK   49 (510)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 410
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=85.56  E-value=0.41  Score=48.58  Aligned_cols=21  Identities=33%  Similarity=0.631  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        26 ~~Gei~~l~G~NGaGKTTLl~   46 (301)
T TIGR03522        26 QKGRIVGFLGPNGAGKSTTMK   46 (301)
T ss_pred             eCCeEEEEECCCCCCHHHHHH
Confidence            568899999999999999655


No 411
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD
Probab=85.45  E-value=0.44  Score=51.62  Aligned_cols=21  Identities=38%  Similarity=0.586  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|+||+|||||..
T Consensus       346 ~~G~~~~ivG~sGsGKSTL~~  366 (529)
T TIGR02857       346 PPGERVALVGPSGAGKSTLLN  366 (529)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 412
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=85.36  E-value=0.43  Score=51.65  Aligned_cols=21  Identities=38%  Similarity=0.650  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|||||||..
T Consensus       287 ~~Ge~~~l~G~NGsGKSTLlk  307 (510)
T PRK09700        287 CRGEILGFAGLVGSGRTELMN  307 (510)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 413
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]
Probab=85.34  E-value=0.42  Score=53.19  Aligned_cols=21  Identities=38%  Similarity=0.699  Sum_probs=19.5

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.+..+.|.||||||||+.
T Consensus       315 ~~GE~lglVGeSGsGKSTlar  335 (539)
T COG1123         315 REGETLGLVGESGSGKSTLAR  335 (539)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            679999999999999999876


No 414
>PF13173 AAA_14:  AAA domain
Probab=85.25  E-value=0.45  Score=41.92  Aligned_cols=20  Identities=35%  Similarity=0.569  Sum_probs=17.7

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      ++..+++.|+-|+|||||..
T Consensus         1 n~~~~~l~G~R~vGKTtll~   20 (128)
T PF13173_consen    1 NRKIIILTGPRGVGKTTLLK   20 (128)
T ss_pred             CCCeEEEECCCCCCHHHHHH
Confidence            46789999999999999876


No 415
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=85.20  E-value=0.46  Score=44.10  Aligned_cols=18  Identities=50%  Similarity=0.687  Sum_probs=16.1

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|+|+.|||||||..
T Consensus        15 ~~ililGl~~sGKTtll~   32 (175)
T PF00025_consen   15 IKILILGLDGSGKTTLLN   32 (175)
T ss_dssp             EEEEEEESTTSSHHHHHH
T ss_pred             EEEEEECCCccchHHHHH
Confidence            469999999999999776


No 416
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=85.18  E-value=0.45  Score=52.03  Aligned_cols=21  Identities=38%  Similarity=0.751  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.+++.|+||+|||||..
T Consensus       347 ~~G~~~aivG~sGsGKSTL~~  367 (547)
T PRK10522        347 KRGELLFLIGGNGSGKSTLAM  367 (547)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999766


No 417
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=85.16  E-value=0.39  Score=46.64  Aligned_cols=19  Identities=32%  Similarity=0.478  Sum_probs=16.5

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      ...+.|.|+||+|||||+.
T Consensus        33 ~~iigi~G~~GsGKTTl~~   51 (229)
T PRK09270         33 RTIVGIAGPPGAGKSTLAE   51 (229)
T ss_pred             CEEEEEECCCCCCHHHHHH
Confidence            3579999999999999876


No 418
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=85.15  E-value=0.42  Score=45.86  Aligned_cols=21  Identities=29%  Similarity=0.681  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.+++|+|++|+|||+|+.
T Consensus        21 ~~g~i~~i~G~~GsGKT~l~~   41 (225)
T PRK09361         21 ERGTITQIYGPPGSGKTNICL   41 (225)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            457789999999999999876


No 419
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=85.14  E-value=0.36  Score=47.31  Aligned_cols=16  Identities=44%  Similarity=0.781  Sum_probs=14.9

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++|.|++|+||||++.
T Consensus         2 Ivl~G~pGSGKST~a~   17 (249)
T TIGR03574         2 IILTGLPGVGKSTFSK   17 (249)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999887


No 420
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=85.12  E-value=0.48  Score=47.90  Aligned_cols=21  Identities=33%  Similarity=0.569  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|+|++|+|||||..
T Consensus        28 ~~Ge~~~IvG~nGsGKSTLl~   48 (275)
T cd03289          28 SPGQRVGLLGRTGSGKSTLLS   48 (275)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 421
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=85.10  E-value=0.31  Score=49.71  Aligned_cols=131  Identities=28%  Similarity=0.342  Sum_probs=79.9

Q ss_pred             CEEEEEeCCCCCcccccc-------cCCCceee---cCceeecC-CCcc-ccCcceEEeecCCCCCCCcchhhcccccce
Q 011221          335 DVALFFGLSGTGKTTLST-------DHNRYLIG---DDEHCWGD-NGVS-NIEGGCYAKCIDLSREKEPDIWNAIKFGAV  402 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~-------~~~~~lI~---DD~~~wsd-~Gvf-n~EgGcYaK~~dLs~e~eP~I~~Ai~f~ai  402 (490)
                      ..++++|--|||||+|..       +.+-+||-   +|+..+.+ -+.. +..-=+-.=|||||=|..-.-|++++  ++
T Consensus        86 NnVLLwGaRGtGKSSLVKA~~~e~~~~glrLVEV~k~dl~~Lp~l~~~Lr~~~~kFIlFcDDLSFe~gd~~yK~LK--s~  163 (287)
T COG2607          86 NNVLLWGARGTGKSSLVKALLNEYADEGLRLVEVDKEDLATLPDLVELLRARPEKFILFCDDLSFEEGDDAYKALK--SA  163 (287)
T ss_pred             cceEEecCCCCChHHHHHHHHHHHHhcCCeEEEEcHHHHhhHHHHHHHHhcCCceEEEEecCCCCCCCchHHHHHH--HH
Confidence            359999999999999765       12333442   44433221 1222 23334556799999877777888876  44


Q ss_pred             eee-eEEcCCCCeeecCCCCccccceEEEecccccCCCCCCCCCCccEEEE--EE-eecCCCCCCccccCHHHHHHH
Q 011221          403 LEN-VVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVIL--LA-CDAFGVLPPVSKLNLAQTMYH  475 (490)
Q Consensus       403 lEN-V~lD~~~~~vdf~d~s~T~NtRa~yPi~~i~N~~~~~~~g~P~~IIf--Lt-~DafgvLPPVskLt~eQA~y~  475 (490)
                      +|. |.=-|+  +|.|.   -|.|.|-.+|.++.+|.... -.-||...+-  ++ .|+||..  ++.-...|.-|.
T Consensus       164 LeG~ve~rP~--NVl~Y---ATSNRRHLl~e~~~dn~~~~-~eih~~eaveEKlSlSDRFGLw--L~F~~~~Q~~YL  232 (287)
T COG2607         164 LEGGVEGRPA--NVLFY---ATSNRRHLLPEDMKDNEGST-GEIHPSEAVEEKLSLSDRFGLW--LSFYPCDQDEYL  232 (287)
T ss_pred             hcCCcccCCC--eEEEE---EecCCcccccHhhhhCCCcc-cccChhHHHHHhhchhhhccee--ecccCCCHHHHH
Confidence            443 222231  33332   24799999999999997533 1246666554  33 7999987  555556666664


No 422
>PRK09087 hypothetical protein; Validated
Probab=85.10  E-value=0.4  Score=47.12  Aligned_cols=19  Identities=37%  Similarity=0.609  Sum_probs=16.8

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      +..++|+|+||+|||+|..
T Consensus        44 ~~~l~l~G~~GsGKThLl~   62 (226)
T PRK09087         44 SPVVVLAGPVGSGKTHLAS   62 (226)
T ss_pred             CCeEEEECCCCCCHHHHHH
Confidence            4569999999999999877


No 423
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=85.07  E-value=0.47  Score=51.52  Aligned_cols=21  Identities=52%  Similarity=0.770  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus       308 ~~Ge~~~l~G~NGsGKSTLl~  328 (520)
T TIGR03269       308 KEGEIFGIVGTSGAGKTTLSK  328 (520)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 424
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=85.05  E-value=0.36  Score=44.76  Aligned_cols=17  Identities=47%  Similarity=0.626  Sum_probs=12.8

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      ..++.|+.||||||+.+
T Consensus        19 ~~~i~GpPGTGKT~~l~   35 (236)
T PF13086_consen   19 ITLIQGPPGTGKTTTLA   35 (236)
T ss_dssp             -EEEE-STTSSHHHHHH
T ss_pred             CEEEECCCCCChHHHHH
Confidence            68999999999998444


No 425
>PRK03731 aroL shikimate kinase II; Reviewed
Probab=85.04  E-value=0.42  Score=43.73  Aligned_cols=30  Identities=23%  Similarity=0.391  Sum_probs=20.8

Q ss_pred             CEEEEEeCCCCCccccccc----CCCceeecCce
Q 011221          335 DVALFFGLSGTGKTTLSTD----HNRYLIGDDEH  364 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~~----~~~~lI~DD~~  364 (490)
                      ..++|+|++||||||++..    .+..++.-|..
T Consensus         3 ~~i~~~G~~GsGKst~~~~la~~lg~~~~d~D~~   36 (171)
T PRK03731          3 QPLFLVGARGCGKTTVGMALAQALGYRFVDTDQW   36 (171)
T ss_pred             CeEEEECCCCCCHHHHHHHHHHHhCCCEEEccHH
Confidence            3588999999999998772    24445544443


No 426
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]
Probab=85.02  E-value=0.37  Score=50.11  Aligned_cols=119  Identities=24%  Similarity=0.375  Sum_probs=59.0

Q ss_pred             CEEEEEeCCCCCccccccc--C--CCce-eecCceeecCCC-----ccccCcce---EEeecCCCCCCCcchhhcc-ccc
Q 011221          335 DVALFFGLSGTGKTTLSTD--H--NRYL-IGDDEHCWGDNG-----VSNIEGGC---YAKCIDLSREKEPDIWNAI-KFG  400 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~~--~--~~~l-I~DD~~~wsd~G-----vfn~EgGc---YaK~~dLs~e~eP~I~~Ai-~f~  400 (490)
                      |-++|||+.|.|||||+.-  .  +-.+ +.. .-.+..-|     ..|+|.|-   -+-.-.|++.-|-.+|.|. -|.
T Consensus        53 DHvLl~GPPGlGKTTLA~IIA~Emgvn~k~ts-Gp~leK~gDlaaiLt~Le~~DVLFIDEIHrl~~~vEE~LYpaMEDf~  131 (332)
T COG2255          53 DHVLLFGPPGLGKTTLAHIIANELGVNLKITS-GPALEKPGDLAAILTNLEEGDVLFIDEIHRLSPAVEEVLYPAMEDFR  131 (332)
T ss_pred             CeEEeeCCCCCcHHHHHHHHHHHhcCCeEecc-cccccChhhHHHHHhcCCcCCeEEEehhhhcChhHHHHhhhhhhhee
Confidence            6799999999999999881  1  1111 110 11111112     12555542   2334446665566666665 242


Q ss_pred             ceeeeeEEcCCCCeeecCCCCccccceEEEecccccCCCCCCCCCCccEEEEEE---eecCCCCCCccccCHHHHHH
Q 011221          401 AVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLA---CDAFGVLPPVSKLNLAQTMY  474 (490)
Q Consensus       401 ailENV~lD~~~~~vdf~d~s~T~NtRa~yPi~~i~N~~~~~~~g~P~~IIfLt---~DafgvLPPVskLt~eQA~y  474 (490)
                      .   -+++...            .|+|.+ .++.=|-.   .+|. -..+=+|+   +|+||+.-.+...++++-..
T Consensus       132 l---DI~IG~g------------p~Arsv-~ldLppFT---LIGA-TTr~G~lt~PLrdRFGi~~rlefY~~~eL~~  188 (332)
T COG2255         132 L---DIIIGKG------------PAARSI-RLDLPPFT---LIGA-TTRAGMLTNPLRDRFGIIQRLEFYTVEELEE  188 (332)
T ss_pred             E---EEEEccC------------CccceE-eccCCCee---Eeee-ccccccccchhHHhcCCeeeeecCCHHHHHH
Confidence            2   3455442            466632 22221111   1111 11111233   89999977777777766544


No 427
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=85.02  E-value=0.41  Score=42.13  Aligned_cols=17  Identities=35%  Similarity=0.606  Sum_probs=15.1

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|++|+|||||..
T Consensus         2 kv~v~G~~~~GKTtli~   18 (164)
T smart00175        2 KIILIGDSGVGKSSLLS   18 (164)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47999999999999766


No 428
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=85.02  E-value=0.46  Score=51.18  Aligned_cols=21  Identities=29%  Similarity=0.532  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        22 ~~Ge~~~liG~nGsGKSTLl~   42 (491)
T PRK10982         22 RPHSIHALMGENGAGKSTLLK   42 (491)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 429
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=85.00  E-value=0.46  Score=46.24  Aligned_cols=39  Identities=31%  Similarity=0.459  Sum_probs=25.5

Q ss_pred             chhhhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCcccccc
Q 011221          300 YAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       300 Y~GEmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      |..+..+.++..+.+.+.+.              ...+++.|++|+|||||..
T Consensus        23 ~~~~~~~~~~~~l~~~~~~~--------------~~~~~l~G~~G~GKTtl~~   61 (269)
T TIGR03015        23 YPSKGHKRAMAYLEYGLSQR--------------EGFILITGEVGAGKTTLIR   61 (269)
T ss_pred             CCCHHHHHHHHHHHHHHhcC--------------CCEEEEEcCCCCCHHHHHH
Confidence            44455555666555544321              2347889999999999877


No 430
>PLN02165 adenylate isopentenyltransferase
Probab=84.97  E-value=0.55  Score=49.42  Aligned_cols=31  Identities=32%  Similarity=0.599  Sum_probs=22.9

Q ss_pred             CCCEEEEEeCCCCCccccccc----CCCceeecCc
Q 011221          333 DGDVALFFGLSGTGKTTLSTD----HNRYLIGDDE  363 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~~----~~~~lI~DD~  363 (490)
                      .|..++|+|++|+|||||+..    .+..+|.-|.
T Consensus        42 ~g~iivIiGPTGSGKStLA~~LA~~l~~eIIsaDs   76 (334)
T PLN02165         42 KDKVVVIMGATGSGKSRLSVDLATRFPSEIINSDK   76 (334)
T ss_pred             CCCEEEEECCCCCcHHHHHHHHHHHcCCceecCCh
Confidence            467899999999999998872    2445565443


No 431
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=84.96  E-value=0.47  Score=51.04  Aligned_cols=21  Identities=33%  Similarity=0.523  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus       284 ~~Ge~~~i~G~NGsGKSTLl~  304 (490)
T PRK10938        284 NPGEHWQIVGPNGAGKSTLLS  304 (490)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 432
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=84.94  E-value=0.43  Score=45.73  Aligned_cols=21  Identities=38%  Similarity=0.673  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.|.|++|||||+|+.
T Consensus        17 ~~g~i~~i~G~~GsGKT~l~~   37 (235)
T cd01123          17 ETGSITEIFGEFGSGKTQLCH   37 (235)
T ss_pred             CCCeEEEEECCCCCCHHHHHH
Confidence            346789999999999999876


No 433
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=84.93  E-value=0.46  Score=51.77  Aligned_cols=21  Identities=29%  Similarity=0.537  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus        33 ~~Ge~~~iiG~nGsGKSTLl~   53 (529)
T PRK15134         33 EAGETLALVGESGSGKSVTAL   53 (529)
T ss_pred             eCCCEEEEECCCCCcHHHHHH
Confidence            468899999999999999854


No 434
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=84.91  E-value=0.4  Score=44.89  Aligned_cols=18  Identities=39%  Similarity=0.440  Sum_probs=16.2

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++++|++|+|||||..
T Consensus         6 ~kivv~G~~g~GKTtl~~   23 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLN   23 (219)
T ss_pred             EEEEEEcCCCccHHHHHH
Confidence            469999999999999877


No 435
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=84.90  E-value=0.5  Score=47.95  Aligned_cols=21  Identities=33%  Similarity=0.607  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        61 ~~Ge~~~liG~NGsGKSTLl~   81 (282)
T cd03291          61 EKGEMLAITGSTGSGKTSLLM   81 (282)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999766


No 436
>TIGR00041 DTMP_kinase thymidylate kinase. Function: phosphorylation of DTMP to form DTDP in both de novo and salvage pathways of DTTP synthesis. Catalytic activity: ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate.
Probab=84.87  E-value=0.42  Score=44.42  Aligned_cols=19  Identities=37%  Similarity=0.592  Sum_probs=16.9

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      |..++|.|+.|+||||++.
T Consensus         3 g~~IvieG~~GsGKsT~~~   21 (195)
T TIGR00041         3 GMFIVIEGIDGAGKTTQAN   21 (195)
T ss_pred             ceEEEEECCCCCCHHHHHH
Confidence            5579999999999999877


No 437
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=84.87  E-value=0.46  Score=41.52  Aligned_cols=17  Identities=29%  Similarity=0.450  Sum_probs=15.1

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|++|+|||||..
T Consensus         2 ki~i~G~~~~GKStli~   18 (162)
T cd04123           2 KVVLLGEGRVGKTSLVL   18 (162)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47999999999999765


No 438
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=84.87  E-value=0.42  Score=41.76  Aligned_cols=17  Identities=29%  Similarity=0.556  Sum_probs=15.2

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|.|++|+|||||..
T Consensus         3 ki~iiG~~~vGKTsl~~   19 (162)
T cd04138           3 KLVVVGAGGVGKSALTI   19 (162)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999876


No 439
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=84.85  E-value=0.5  Score=44.99  Aligned_cols=21  Identities=38%  Similarity=0.616  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.++.++|++|+|||+|+.
T Consensus        17 ~~g~v~~I~G~~GsGKT~l~~   37 (226)
T cd01393          17 PTGRITEIFGEFGSGKTQLCL   37 (226)
T ss_pred             cCCcEEEEeCCCCCChhHHHH
Confidence            347899999999999999776


No 440
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes.
Probab=84.81  E-value=0.49  Score=51.54  Aligned_cols=21  Identities=38%  Similarity=0.680  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|.||+|||||..
T Consensus       356 ~~G~~v~IvG~sGsGKSTLl~  376 (571)
T TIGR02203       356 EPGETVALVGRSGSGKSTLVN  376 (571)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 441
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).
Probab=84.78  E-value=0.47  Score=51.17  Aligned_cols=21  Identities=33%  Similarity=0.582  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|+|||||..
T Consensus        25 ~~Ge~~~liG~nGsGKSTLl~   45 (500)
T TIGR02633        25 RPGECVGLCGENGAGKSTLMK   45 (500)
T ss_pred             eCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 442
>PRK07667 uridine kinase; Provisional
Probab=84.67  E-value=0.43  Score=45.31  Aligned_cols=18  Identities=39%  Similarity=0.357  Sum_probs=15.9

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..+.+-|.+|+||||++.
T Consensus        18 ~iIgI~G~~gsGKStla~   35 (193)
T PRK07667         18 FILGIDGLSRSGKTTFVA   35 (193)
T ss_pred             EEEEEECCCCCCHHHHHH
Confidence            368999999999999877


No 443
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=84.66  E-value=0.49  Score=51.53  Aligned_cols=21  Identities=33%  Similarity=0.533  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|+||+|||||..
T Consensus       310 ~~Ge~~~i~G~nGsGKSTLlk  330 (529)
T PRK15134        310 RPGETLGLVGESGSGKSTTGL  330 (529)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 444
>PRK12288 GTPase RsgA; Reviewed
Probab=84.66  E-value=1.6  Score=45.88  Aligned_cols=19  Identities=42%  Similarity=0.872  Sum_probs=17.2

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      +..++|.|.||+|||||.+
T Consensus       205 ~ki~~~vG~sgVGKSTLiN  223 (347)
T PRK12288        205 GRISIFVGQSGVGKSSLIN  223 (347)
T ss_pred             hCCEEEECCCCCCHHHHHH
Confidence            4579999999999999888


No 445
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.
Probab=84.65  E-value=0.46  Score=47.69  Aligned_cols=20  Identities=35%  Similarity=0.441  Sum_probs=17.9

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .|..++|||++|+|||||..
T Consensus        15 ~Gqr~~I~G~~G~GKTTLlr   34 (249)
T cd01128          15 KGQRGLIVAPPKAGKTTLLQ   34 (249)
T ss_pred             CCCEEEEECCCCCCHHHHHH
Confidence            47789999999999999876


No 446
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family. This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
Probab=84.65  E-value=0.43  Score=47.66  Aligned_cols=20  Identities=30%  Similarity=0.326  Sum_probs=17.9

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .|.++++.|.+|||||||+.
T Consensus        35 ~gs~~lI~G~pGtGKT~l~~   54 (259)
T TIGR03878        35 AYSVINITGVSDTGKSLMVE   54 (259)
T ss_pred             CCcEEEEEcCCCCCHHHHHH
Confidence            46789999999999999877


No 447
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=84.59  E-value=0.46  Score=51.49  Aligned_cols=21  Identities=33%  Similarity=0.673  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        29 ~~Ge~~~l~G~nGsGKSTLl~   49 (506)
T PRK13549         29 RAGEIVSLCGENGAGKSTLMK   49 (506)
T ss_pred             eCCeEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 448
>PRK13946 shikimate kinase; Provisional
Probab=84.59  E-value=0.46  Score=44.63  Aligned_cols=19  Identities=32%  Similarity=0.611  Sum_probs=16.7

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      ...++|.|++||||||++.
T Consensus        10 ~~~I~l~G~~GsGKsti~~   28 (184)
T PRK13946         10 KRTVVLVGLMGAGKSTVGR   28 (184)
T ss_pred             CCeEEEECCCCCCHHHHHH
Confidence            3579999999999999877


No 449
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=84.58  E-value=0.39  Score=43.96  Aligned_cols=16  Identities=50%  Similarity=0.669  Sum_probs=14.6

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      +++.|++|||||+|+.
T Consensus         2 ~li~G~~G~GKT~l~~   17 (187)
T cd01124           2 TLLSGGPGTGKTTFAL   17 (187)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            6899999999999876


No 450
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=84.54  E-value=0.84  Score=47.74  Aligned_cols=21  Identities=38%  Similarity=0.670  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|.++.+.|.||||||||+.
T Consensus        29 ~~GE~lgiVGESGsGKS~~~~   49 (316)
T COG0444          29 KKGEILGIVGESGSGKSVLAK   49 (316)
T ss_pred             cCCcEEEEEcCCCCCHHHHHH
Confidence            568999999999999999877


No 451
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=84.51  E-value=0.51  Score=51.93  Aligned_cols=21  Identities=29%  Similarity=0.553  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|.||+|||||..
T Consensus       365 ~~Ge~iaIvG~SGsGKSTLl~  385 (592)
T PRK10790        365 PSRGFVALVGHTGSGKSTLAS  385 (592)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            678999999999999999766


No 452
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=84.50  E-value=0.6  Score=45.85  Aligned_cols=20  Identities=30%  Similarity=0.559  Sum_probs=16.6

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      +....+|.|+||+|||||..
T Consensus        24 ~~~~~~IvG~NGsGKStll~   43 (251)
T cd03273          24 DPQFNAITGLNGSGKSNILD   43 (251)
T ss_pred             CCCeEEEECCCCCCHHHHHH
Confidence            45678999999999999654


No 453
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=84.49  E-value=0.44  Score=52.36  Aligned_cols=20  Identities=40%  Similarity=0.632  Sum_probs=17.7

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .|.+++|+|++|+||||+.+
T Consensus       255 ~g~Vi~LvGpnGvGKTTTia  274 (484)
T PRK06995        255 RGGVFALMGPTGVGKTTTTA  274 (484)
T ss_pred             CCcEEEEECCCCccHHHHHH
Confidence            46799999999999999766


No 454
>PRK14528 adenylate kinase; Provisional
Probab=84.42  E-value=0.46  Score=44.93  Aligned_cols=17  Identities=35%  Similarity=0.610  Sum_probs=15.5

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|++|+||||++.
T Consensus         3 ~i~i~G~pGsGKtt~a~   19 (186)
T PRK14528          3 NIIFMGPPGAGKGTQAK   19 (186)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999877


No 455
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=84.40  E-value=0.5  Score=51.17  Aligned_cols=21  Identities=33%  Similarity=0.626  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.++++|++|+|||||..
T Consensus       286 ~~Ge~~~l~G~NGsGKSTLlk  306 (506)
T PRK13549        286 RRGEILGIAGLVGAGRTELVQ  306 (506)
T ss_pred             cCCcEEEEeCCCCCCHHHHHH
Confidence            568899999999999999766


No 456
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=84.39  E-value=0.49  Score=41.51  Aligned_cols=17  Identities=29%  Similarity=0.587  Sum_probs=15.0

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++++|.+|+|||||..
T Consensus         2 ki~~~G~~~~GKTsl~~   18 (164)
T cd04139           2 KVIVVGAGGVGKSALTL   18 (164)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999755


No 457
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=84.38  E-value=0.53  Score=51.29  Aligned_cols=21  Identities=29%  Similarity=0.463  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus        25 ~~Ge~~~liG~NGsGKSTLl~   45 (530)
T PRK15064         25 GGGNRYGLIGANGCGKSTFMK   45 (530)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 458
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional
Probab=84.37  E-value=0.45  Score=45.49  Aligned_cols=18  Identities=44%  Similarity=0.470  Sum_probs=15.6

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      .++.|.|.||||||||..
T Consensus         7 ~ii~ivG~sgsGKTTLi~   24 (173)
T PRK10751          7 PLLAIAAWSGTGKTTLLK   24 (173)
T ss_pred             eEEEEECCCCChHHHHHH
Confidence            368999999999999755


No 459
>PF06745 KaiC:  KaiC;  InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria [].  The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....
Probab=84.33  E-value=0.54  Score=45.13  Aligned_cols=21  Identities=48%  Similarity=0.700  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|||||+|+.
T Consensus        17 p~gs~~li~G~~GsGKT~l~~   37 (226)
T PF06745_consen   17 PKGSVVLISGPPGSGKTTLAL   37 (226)
T ss_dssp             ETTSEEEEEESTTSSHHHHHH
T ss_pred             CCCcEEEEEeCCCCCcHHHHH
Confidence            347799999999999999876


No 460
>PRK04182 cytidylate kinase; Provisional
Probab=84.32  E-value=0.46  Score=43.12  Aligned_cols=17  Identities=35%  Similarity=0.579  Sum_probs=15.3

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .+++.|.+||||||++.
T Consensus         2 ~I~i~G~~GsGKstia~   18 (180)
T PRK04182          2 IITISGPPGSGKTTVAR   18 (180)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999877


No 461
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]
Probab=84.31  E-value=0.31  Score=54.26  Aligned_cols=21  Identities=29%  Similarity=0.561  Sum_probs=18.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+.|.|.||+||||+..
T Consensus       376 ~kGekVaIvG~nGsGKSTilr  396 (591)
T KOG0057|consen  376 PKGEKVAIVGSNGSGKSTILR  396 (591)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            457889999999999999655


No 462
>PRK13536 nodulation factor exporter subunit NodI; Provisional
Probab=84.28  E-value=0.54  Score=49.00  Aligned_cols=21  Identities=29%  Similarity=0.581  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+.|.|++|+|||||..
T Consensus        65 ~~Gei~gLlGpNGaGKSTLl~   85 (340)
T PRK13536         65 ASGECFGLLGPNGAGKSTIAR   85 (340)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568999999999999999655


No 463
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=84.26  E-value=0.55  Score=43.39  Aligned_cols=21  Identities=43%  Similarity=0.713  Sum_probs=17.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|+|++|+||||++.
T Consensus        30 ~~g~l~~i~g~~g~GKT~~~~   50 (193)
T PF13481_consen   30 PRGELTLIAGPPGSGKTTLAL   50 (193)
T ss_dssp             -TTSEEEEEECSTSSHHHHHH
T ss_pred             cCCeEEEEEeCCCCCHHHHHH
Confidence            357799999999999999766


No 464
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=84.24  E-value=0.47  Score=51.11  Aligned_cols=42  Identities=29%  Similarity=0.386  Sum_probs=27.0

Q ss_pred             hHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCcccccc
Q 011221          304 MKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       304 mKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      .++.+...+.-.++..+..       ....|.+++|.|++|+||||+++
T Consensus       198 ~~~~~~~~L~~~l~~~~~~-------~~~~~~~i~~vGptGvGKTTt~~  239 (424)
T PRK05703        198 AWRYLLELLANMIPVRVED-------ILKQGGVVALVGPTGVGKTTTLA  239 (424)
T ss_pred             HHHHHHHHHHHHhCccccc-------cccCCcEEEEECCCCCCHHHHHH
Confidence            5566666654444432221       12236799999999999999666


No 465
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=84.17  E-value=0.52  Score=45.23  Aligned_cols=21  Identities=33%  Similarity=0.381  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|||||||+.
T Consensus        18 ~~G~~~~i~G~~G~GKT~l~~   38 (229)
T TIGR03881        18 PRGFFVAVTGEPGTGKTIFCL   38 (229)
T ss_pred             cCCeEEEEECCCCCChHHHHH
Confidence            347789999999999999765


No 466
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=84.09  E-value=0.52  Score=41.43  Aligned_cols=17  Identities=29%  Similarity=0.477  Sum_probs=15.2

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|.+|+|||||..
T Consensus         2 ki~~vG~~~vGKTsli~   18 (168)
T cd04119           2 KVISMGNSGVGKSCIIK   18 (168)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47999999999999876


No 467
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=84.04  E-value=0.48  Score=40.63  Aligned_cols=17  Identities=41%  Similarity=0.552  Sum_probs=15.1

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++++|++|+|||||..
T Consensus         2 ~i~~~G~~~~GKStl~~   18 (159)
T cd00154           2 KIVLIGDSGVGKTSLLL   18 (159)
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            47899999999999766


No 468
>PF03205 MobB:  Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A.
Probab=84.02  E-value=0.53  Score=43.05  Aligned_cols=17  Identities=41%  Similarity=0.495  Sum_probs=15.4

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      +++|.|.+++|||||..
T Consensus         2 vv~VvG~~~sGKTTl~~   18 (140)
T PF03205_consen    2 VVQVVGPKNSGKTTLIR   18 (140)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            58999999999999876


No 469
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=83.96  E-value=0.56  Score=44.54  Aligned_cols=20  Identities=30%  Similarity=0.373  Sum_probs=17.3

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .|+.+++.|++|+|||||..
T Consensus        28 ~~~~~~l~G~Ng~GKStll~   47 (202)
T cd03243          28 SGRLLLITGPNMGGKSTYLR   47 (202)
T ss_pred             CCeEEEEECCCCCccHHHHH
Confidence            35899999999999999654


No 470
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=83.95  E-value=0.54  Score=50.86  Aligned_cols=21  Identities=33%  Similarity=0.605  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus       276 ~~Ge~~~liG~NGsGKSTLl~  296 (501)
T PRK10762        276 RKGEILGVSGLMGAGRTELMK  296 (501)
T ss_pred             cCCcEEEEecCCCCCHHHHHH
Confidence            568899999999999999765


No 471
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=83.94  E-value=0.56  Score=51.08  Aligned_cols=21  Identities=38%  Similarity=0.566  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus       343 ~~Ge~~~l~G~NGsGKSTLl~  363 (530)
T PRK15064        343 EAGERLAIIGENGVGKTTLLR  363 (530)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 472
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=83.92  E-value=0.59  Score=46.63  Aligned_cols=21  Identities=38%  Similarity=0.718  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|.+|+|||||..
T Consensus        28 ~~Ge~~~i~G~nGsGKSTL~~   48 (235)
T COG1122          28 EKGERVLLIGPNGSGKSTLLK   48 (235)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 473
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional
Probab=83.86  E-value=0.56  Score=51.01  Aligned_cols=21  Identities=38%  Similarity=0.664  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..+++.|++|+|||||..
T Consensus        35 ~~Ge~~~liG~NGsGKSTLl~   55 (510)
T PRK15439         35 HAGEVHALLGGNGAGKSTLMK   55 (510)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468899999999999999765


No 474
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=83.86  E-value=0.44  Score=48.75  Aligned_cols=18  Identities=50%  Similarity=0.820  Sum_probs=16.3

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|+|++|||||||+.
T Consensus        52 ~~~ll~GppG~GKT~la~   69 (328)
T PRK00080         52 DHVLLYGPPGLGKTTLAN   69 (328)
T ss_pred             CcEEEECCCCccHHHHHH
Confidence            468999999999999877


No 475
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=83.81  E-value=0.57  Score=51.68  Aligned_cols=21  Identities=38%  Similarity=0.653  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|+||+|||||..
T Consensus       364 ~~G~~~aivG~sGsGKSTL~~  384 (574)
T PRK11160        364 KAGEKVALLGRTGCGKSTLLQ  384 (574)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 476
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=83.77  E-value=0.5  Score=49.05  Aligned_cols=20  Identities=40%  Similarity=0.463  Sum_probs=17.8

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+.+++|.|++|+||||+++
T Consensus       113 ~~~vi~lvGpnGsGKTTt~~  132 (318)
T PRK10416        113 KPFVILVVGVNGVGKTTTIG  132 (318)
T ss_pred             CCeEEEEECCCCCcHHHHHH
Confidence            46789999999999999776


No 477
>TIGR02173 cyt_kin_arch cytidylate kinase, putative. Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.
Probab=83.76  E-value=0.51  Score=42.59  Aligned_cols=17  Identities=35%  Similarity=0.585  Sum_probs=15.4

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .+++.|.+|+||||++.
T Consensus         2 iI~i~G~~GSGKstia~   18 (171)
T TIGR02173         2 IITISGPPGSGKTTVAK   18 (171)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999877


No 478
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional
Probab=83.71  E-value=0.6  Score=48.40  Aligned_cols=21  Identities=43%  Similarity=0.646  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++|.|++|+|||||..
T Consensus       106 ~~Ge~v~IvG~~GsGKSTLl~  126 (329)
T PRK14257        106 KRNKVTAFIGPSGCGKSTFLR  126 (329)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 479
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism]
Probab=83.65  E-value=0.36  Score=45.87  Aligned_cols=26  Identities=42%  Similarity=0.710  Sum_probs=17.9

Q ss_pred             EeCCCCCcccccc----cCCCcee-ecCcee
Q 011221          340 FGLSGTGKTTLST----DHNRYLI-GDDEHC  365 (490)
Q Consensus       340 fGlSGtGKTTLs~----~~~~~lI-~DD~~~  365 (490)
                      ||.|||||||...    .-+-..| +||.|-
T Consensus         1 MGVsG~GKStvg~~lA~~lg~~fidGDdlHp   31 (161)
T COG3265           1 MGVSGSGKSTVGSALAERLGAKFIDGDDLHP   31 (161)
T ss_pred             CCCCccCHHHHHHHHHHHcCCceecccccCC
Confidence            6899999999665    2233444 787764


No 480
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=83.64  E-value=0.56  Score=42.55  Aligned_cols=18  Identities=22%  Similarity=0.392  Sum_probs=16.0

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++|.|++|+|||||..
T Consensus         2 ~kv~l~G~~g~GKTtl~~   19 (180)
T cd04137           2 RKIAVLGSRSVGKSSLTV   19 (180)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            468999999999999876


No 481
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]
Probab=83.60  E-value=0.59  Score=46.29  Aligned_cols=21  Identities=38%  Similarity=0.646  Sum_probs=17.2

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|.=+.+.|+||+|||||..
T Consensus        26 ~~Gef~fl~GpSGAGKSTllk   46 (223)
T COG2884          26 PKGEFVFLTGPSGAGKSTLLK   46 (223)
T ss_pred             cCceEEEEECCCCCCHHHHHH
Confidence            346678999999999999654


No 482
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion.
Probab=83.59  E-value=0.59  Score=51.04  Aligned_cols=21  Identities=38%  Similarity=0.691  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|+||+|||||..
T Consensus       342 ~~G~~~~ivG~sGsGKSTL~~  362 (544)
T TIGR01842       342 QAGEALAIIGPSGSGKSTLAR  362 (544)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 483
>PRK15453 phosphoribulokinase; Provisional
Probab=83.53  E-value=0.6  Score=48.31  Aligned_cols=19  Identities=32%  Similarity=0.426  Sum_probs=16.6

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      .-.+++.|.|||||||++.
T Consensus         5 ~piI~ItG~SGsGKTTva~   23 (290)
T PRK15453          5 HPIIAVTGSSGAGTTTVKR   23 (290)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            4569999999999999876


No 484
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=83.52  E-value=0.52  Score=41.81  Aligned_cols=17  Identities=29%  Similarity=0.575  Sum_probs=15.1

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|.|++|+|||||..
T Consensus         2 ki~v~G~~~~GKTsli~   18 (164)
T smart00173        2 KLVVLGSGGVGKSALTI   18 (164)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999865


No 485
>PLN02772 guanylate kinase
Probab=83.47  E-value=1.5  Score=47.34  Aligned_cols=46  Identities=28%  Similarity=0.359  Sum_probs=31.5

Q ss_pred             cccchhhhHHHHHHHHHHhcccCCeeeeccccccCCCCCEEEEEeCCCCCcccccc
Q 011221          297 GTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       297 Gt~Y~GEmKK~iltl~~~~l~~~G~L~~H~sani~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +|.|-.+-||.         ..+-+..++=+ +.+...+.++|.|+||+||+||..
T Consensus       108 ~t~~~~~~~~~---------~~~eV~~~~~~-~~~~~~k~iVlsGPSGvGKsTL~~  153 (398)
T PLN02772        108 DTPFVREQKKL---------LGTEVVAWSKG-VRGNAEKPIVISGPSGVGKGTLIS  153 (398)
T ss_pred             CCHHHHhhccc---------ccceeeecccC-CCCCCCcEEEEECCCCCCHHHHHH
Confidence            57777666662         23445555433 244556789999999999999766


No 486
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc.
Probab=83.45  E-value=0.6  Score=52.66  Aligned_cols=21  Identities=38%  Similarity=0.612  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|+.+++.|.||+|||||..
T Consensus       498 ~~G~~vaIvG~SGsGKSTLlk  518 (708)
T TIGR01193       498 KMNSKTTIVGMSGSGKSTLAK  518 (708)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            458899999999999999766


No 487
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).
Probab=83.43  E-value=0.57  Score=50.56  Aligned_cols=21  Identities=33%  Similarity=0.612  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.++++|++|+|||||..
T Consensus       284 ~~Ge~~~l~G~NGsGKSTLl~  304 (500)
T TIGR02633       284 RRGEILGVAGLVGAGRTELVQ  304 (500)
T ss_pred             eCCcEEEEeCCCCCCHHHHHH
Confidence            568899999999999999765


No 488
>PRK08181 transposase; Validated
Probab=83.43  E-value=0.56  Score=47.66  Aligned_cols=20  Identities=40%  Similarity=0.722  Sum_probs=17.2

Q ss_pred             CCCEEEEEeCCCCCcccccc
Q 011221          333 DGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       333 ~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+..++|+|++|||||.|+.
T Consensus       105 ~~~nlll~Gp~GtGKTHLa~  124 (269)
T PRK08181        105 KGANLLLFGPPGGGKSHLAA  124 (269)
T ss_pred             cCceEEEEecCCCcHHHHHH
Confidence            34579999999999999877


No 489
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=83.41  E-value=0.57  Score=41.75  Aligned_cols=18  Identities=33%  Similarity=0.440  Sum_probs=15.8

Q ss_pred             CEEEEEeCCCCCcccccc
Q 011221          335 DVALFFGLSGTGKTTLST  352 (490)
Q Consensus       335 ~~~lffGlSGtGKTTLs~  352 (490)
                      ..++++|++|+|||||..
T Consensus         8 ~~v~v~G~~~~GKSsli~   25 (169)
T cd04114           8 FKIVLIGNAGVGKTCLVR   25 (169)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            469999999999999765


No 490
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter. This model describes cyclic peptide transporter in bacteria. Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. Syringomycin is an amphipathic, cylclic lipodepsipeptide when inserted into host causes formation of channels, permeable to variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake.
Probab=83.41  E-value=0.59  Score=51.35  Aligned_cols=21  Identities=38%  Similarity=0.760  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..++++|+||+|||||..
T Consensus       366 ~~G~~~aivG~sGsGKSTl~~  386 (555)
T TIGR01194       366 AQGDIVFIVGENGCGKSTLAK  386 (555)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 491
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated
Probab=83.33  E-value=0.56  Score=52.42  Aligned_cols=22  Identities=45%  Similarity=0.750  Sum_probs=19.0

Q ss_pred             CCCCCEEEEEeCCCCCcccccc
Q 011221          331 GKDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       331 ~~~g~~~lffGlSGtGKTTLs~  352 (490)
                      .+.|.+++|.|+|||||||++.
T Consensus       389 ~~~g~~Ivl~Gl~GSGKSTia~  410 (568)
T PRK05537        389 HKQGFTVFFTGLSGAGKSTIAK  410 (568)
T ss_pred             cCCCeEEEEECCCCChHHHHHH
Confidence            3557789999999999999877


No 492
>PF13521 AAA_28:  AAA domain; PDB: 1LW7_A.
Probab=83.31  E-value=0.41  Score=43.58  Aligned_cols=16  Identities=44%  Similarity=0.464  Sum_probs=13.0

Q ss_pred             EEEEeCCCCCcccccc
Q 011221          337 ALFFGLSGTGKTTLST  352 (490)
Q Consensus       337 ~lffGlSGtGKTTLs~  352 (490)
                      ++|.|..|||||||+.
T Consensus         2 I~i~G~~stGKTTL~~   17 (163)
T PF13521_consen    2 IVITGGPSTGKTTLIE   17 (163)
T ss_dssp             EEEE--TTSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHH
Confidence            7899999999999887


No 493
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=83.23  E-value=0.58  Score=42.94  Aligned_cols=19  Identities=47%  Similarity=0.665  Sum_probs=16.5

Q ss_pred             CCEEEEEeCCCCCcccccc
Q 011221          334 GDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       334 g~~~lffGlSGtGKTTLs~  352 (490)
                      ...++|.|++|+|||||..
T Consensus        19 ~~ki~ilG~~~~GKStLi~   37 (190)
T cd00879          19 EAKILFLGLDNAGKTTLLH   37 (190)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            4568999999999999876


No 494
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=83.21  E-value=0.6  Score=50.34  Aligned_cols=21  Identities=24%  Similarity=0.465  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+.+.|++|+|||||..
T Consensus       272 ~~Ge~~~l~G~nGsGKSTLl~  292 (491)
T PRK10982        272 HKGEILGIAGLVGAKRTDIVE  292 (491)
T ss_pred             eCCcEEEEecCCCCCHHHHHH
Confidence            568899999999999999755


No 495
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=83.21  E-value=0.62  Score=51.27  Aligned_cols=21  Identities=38%  Similarity=0.593  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      +.|..+++.|+||+|||||..
T Consensus       339 ~~G~~~~ivG~sGsGKSTLl~  359 (569)
T PRK10789        339 KPGQMLGICGPTGSGKSTLLS  359 (569)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999765


No 496
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=83.15  E-value=0.6  Score=50.52  Aligned_cols=21  Identities=33%  Similarity=0.789  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|||||||..
T Consensus       277 ~~Ge~~~iiG~NGsGKSTLlk  297 (501)
T PRK11288        277 RAGEIVGLFGLVGAGRSELMK  297 (501)
T ss_pred             eCCcEEEEEcCCCCCHHHHHH
Confidence            568899999999999999765


No 497
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=83.14  E-value=0.55  Score=42.22  Aligned_cols=17  Identities=29%  Similarity=0.470  Sum_probs=15.1

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++++|++|+|||||..
T Consensus         2 ki~vvG~~~vGKTsli~   18 (161)
T cd04124           2 KIILLGDSAVGKSKLVE   18 (161)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999876


No 498
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=83.14  E-value=0.63  Score=52.14  Aligned_cols=21  Identities=33%  Similarity=0.583  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|..++++|++|||||||..
T Consensus        27 ~~Ge~v~LvG~NGsGKSTLLr   47 (635)
T PRK11147         27 EDNERVCLVGRNGAGKSTLMK   47 (635)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 499
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=83.10  E-value=0.65  Score=51.13  Aligned_cols=21  Identities=38%  Similarity=0.504  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeCCCCCcccccc
Q 011221          332 KDGDVALFFGLSGTGKTTLST  352 (490)
Q Consensus       332 ~~g~~~lffGlSGtGKTTLs~  352 (490)
                      ..|+.+++.|++|+|||||..
T Consensus        31 ~~Ge~~~iiG~NGsGKSTLlk   51 (556)
T PRK11819         31 FPGAKIGVLGLNGAGKSTLLR   51 (556)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            568899999999999999766


No 500
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=83.07  E-value=0.54  Score=41.85  Aligned_cols=17  Identities=35%  Similarity=0.473  Sum_probs=15.1

Q ss_pred             EEEEEeCCCCCcccccc
Q 011221          336 VALFFGLSGTGKTTLST  352 (490)
Q Consensus       336 ~~lffGlSGtGKTTLs~  352 (490)
                      .++|+|++|+|||||..
T Consensus         2 ~v~ivG~~~~GKStl~~   18 (170)
T cd01898           2 DVGLVGLPNAGKSTLLS   18 (170)
T ss_pred             CeEEECCCCCCHHHHHH
Confidence            37899999999999877


Done!