Citrus Sinensis ID: 011250


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490
MGLSPESVKVKNWEVNNSDNNNNSKSRKVKKKKDGGAEQEEEEEIGCWVRFRFIESCMPSRSKVDSSMSGTSTNYADGKSSNEKRRDRPVVPVSSTTTSNAESASSTPKFSEELKVASQLRKFMFNDLKLATRNFRPESLLGEGGFGCVFKGWVEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNFLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAEKPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPEDGKTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLGDKRRFYRLLDPRLEGHFSIKGSQKATQLAAQCLSRDPKARPRMSEVVETLKPLQNLKDMASSSYYFQTMQADNTWSIRNSKNGIRTQGGFMTRNGQPLRTLSHPNGPHASPYRHPQQSPKPNGKQ
ccccccccccccccccccccccccccccccccccccccHHcccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHcccccccccccccccEEEEEEEccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHcccccccccEEEEEccccCEEEEEEEcccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccEECcccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHHHcccccccccccccccHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
********************************************IGCWVRFRFIESC*************************************************************QLRKFMFNDLKLATRNFRPESLLGEGGFGCVFKGWVEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNFLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAEKPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPEDGKTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLGDKRRFYRLLDPRLEGHFSIKGSQKATQLAAQCLSRDPKARPRMSEVVETLKPL************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLSPESVKVKNWEVNNSDNNNNSKSRKVKKKKDGGAEQEEEEEIGCWVRFRFIESCMPSRSKVDSSMSGTSTNYADGKSSNEKRRDRPVVPVSSTTTSNAESASSTPKFSEELKVASQLRKFMFNDLKLATRNFRPESLLGEGGFGCVFKGWVEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNFLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAEKPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPEDGKTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLGDKRRFYRLLDPRLEGHFSIKGSQKATQLAAQCLSRDPKARPRMSEVVETLKPLQNLKDMASSSYYFQTMQADNTWSIRNSKNGIRTQGGFMTRNGQPLRTLSHPNGPHASPYRHPQQSPKPNGKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable receptor-like protein kinase At5g15080 confidentQ9LFP7
Receptor-like serine/threonine-protein kinase At3g01300 probableQ9SRH7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QD2, chain B
Confidence level:very confident
Coverage over the Query: 133-361,375-414
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 118-155,166-418
View the alignment between query and template
View the model in PyMOL
Template: 1UU3, chain A
Confidence level:confident
Coverage over the Query: 126-293,305-342
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:confident
Coverage over the Query: 134-362,376-442
View the alignment between query and template
View the model in PyMOL
Template: 3PVU, chain A
Confidence level:confident
Coverage over the Query: 40-342
View the alignment between query and template
View the model in PyMOL