Citrus Sinensis ID: 011253


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490
MENNKEEIVDVGSVVEAVSADDSDAPLYQVESLCMRCGENGVTRFLLTLIPHFRKVLLSAFECPHCGERNNEVQFAGEIQPRGCNYSLKVPSSDQKMFHRQVVKSESATIKIPELDFEIPPEAQRGSLSTVEGILVRAADELEALQEERKKLDPQTAEAIDQFLLKLRACAKGDSTFTFILDDPAGNSFIENLYAPSPDPSLNIKFYERTPEQQALLGYLVDPSQQGESSNVVPSEGLSSTSDKREPRGSVGAVAGHRAIAQSNSAEIADALFRYSAPEEVMTFPSTCGACAASCETRMFMTRIPYFQEVIVMASTCDACGYRNSELKPGGRIPEKGKRITLFVKNINDLSRDLIKSDTAGVKIPELDLELAGGTLGGIVTTVEGLITKISESLERVHGFSFGDSLDENKRTKWQDFKAKLNKLLSVEESWTLILDDALANSFIAPVTDDIKDDHQLTFEEYERSWEQNEELGLNDIDTSSADAAYNSTS
cccccccccccccccccccccccccccEEEEccccccccccEEEEEEEccccccEEEEEEEEcccccccccccCCcccccccCEEEEEEEEcccccccccEEEEcccEEEEEccccEECcccccccccCCHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccECccccccccccCEEEEccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccEEEEEEEcccccEEEEEEEccccccccccccccccccccccCEEEEEEccccccccEEEECccCEEEEccccEEEcccccccEEEcHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccEEEEEEccHHHHHHHcccccccccccccccccc
************************APLYQVESLCMRCGENGVTRFLLTLIPHFRKVLLSAFECPHCGERNNEVQFAGEIQPRGCNYSLKVPSSDQKMFHRQVVKSESATIKIPELDFEIPPEAQRGSLSTVEGILVRAADELEALQEE****DPQTAEAIDQFLLKLRACAKGDSTFTFILDDPAGNSFIENLYAPSPDPSLNIKFYERTPEQQALLGYLV**************************************************LFRYSAPEEVMTFPSTCGACAASCETRMFMTRIPYFQEVIVMASTCDACGYRNSELKPGGRIPEKGKRITLFVKNINDLSRDLIKSDTAGVKIPELDLELAGGTLGGIVTTVEGLITKISESLERVH******SLDENKRTKWQDFKAKLNKLLSVEESWTLILDDALANSFIAPVTDDIKDDHQLTFEEYERSWEQNEELGLNDI*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENNKEEIVDVGSVVEAVSADDSDAPLYQVESLCMRCGENGVTRFLLTLIPHFRKVLLSAFECPHCGERNNEVQFAGEIQPRGCNYSLKVPSSDQKMFHRQVVKSESATIKIPELDFEIPPEAQRGSxxxxxxxxxxxxxxxxxxxxxRKKLDPQTAEAIDQFLLKLRACAKGDSTFTFILDDPAGNSFIENLYAPSPDPSLNIKFYERTPEQQALLGYLVDPSQQGESSNVVPSEGLSSTSDKREPRGSVGAVAGHRAIAQSNSAEIADALFRYSAPEEVMTFPSTCGACAASCETRMFMTRIPYFQEVIVMASTCDACGYRNSELKPGGRIPEKGKRITLFVKNINDLSRDLIKSDTAGVKIPELDLELAGGTLGGIVTTVEGLITKISESLERVHGFSFGDSLDENKRTKWQDFKAKLNKLLSVEESWTLILDDALANSFIAPVTDDIKDDHQLTFEEYERSWEQNEELGLNDIDTSSADAAYNSTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein ZPR1 May be a signaling molecule that communicates mitogenic signals from the cytoplasm to the nucleus.probableO75312
Zinc finger protein zpr1 probableO13724
Zinc finger protein ZPR1 May be a signaling molecule that communicates mitogenic signals from the cytoplasm to the nucleus.probableQ2TBX0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QKD, chain A
Confidence level:very confident
Coverage over the Query: 30-221,265,277-471
View the alignment between query and template
View the model in PyMOL