BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 011274
         (489 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1YCO|A Chain A, Crystal Structure Of A Branched-Chain Phosphotransacylase
           From Enterococcus Faecalis V583
 pdb|1YCO|B Chain B, Crystal Structure Of A Branched-Chain Phosphotransacylase
           From Enterococcus Faecalis V583
          Length = 279

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 38  SAVEVSKALAPQHPQLIL--------SKTPSSVIQEDLAAELEDQNGAVSGNPFSFACSE 89
           +A EV++ L   HP++ L         K PSSV+ +++ A   DQ  A    P S   + 
Sbjct: 136 NAKEVAQKLGLHHPKIALLSAAENFNPKMPSSVLAKEVTAHFNDQQEATVFGPLSLDLAT 195

Query: 90  TSQMIMER 97
           + + +  +
Sbjct: 196 SEEAVAHK 203


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.133    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,878,621
Number of Sequences: 62578
Number of extensions: 354127
Number of successful extensions: 737
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 737
Number of HSP's gapped (non-prelim): 1
length of query: 489
length of database: 14,973,337
effective HSP length: 103
effective length of query: 386
effective length of database: 8,527,803
effective search space: 3291731958
effective search space used: 3291731958
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)