Citrus Sinensis ID: 011352


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MTQDVEMKDKENPSNSLSSPFTPSTLHHLKEIASLMETGAHAREVRRIMRAVRLTMALRRKLKAPVLSAFLNFALAPGSEAHSRLLSYLPKEDEHEMEVDTASSGAPAPAKHPLPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQCNKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKSVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVSKAIRDGAIDATVDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF
ccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHHHHHcccEEEEEEccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccc
**************************HHLKEIASLMETGAHAREVRRIMRAVRLTMALRRKLKAPVLSAFLNFALAPGSEAHSRLLSYLP**********************PLPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQCNKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKSVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVSKAIRDGAIDATVDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRAL*******************************E******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTQDVEMKDKENPSNSLSSPFTPSTLHHLKEIASLMETGAHAREVRRIMRAVRLTMALRRKLKAPVLSAFLNFALAPGSEAHSRLLSYLPKEDEHEMEVDTASSGAPAPAKHPLPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNRRTVDVLAARLYFYYSLCYELTGDLAEIRGNLLALHRIATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQCNKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKSVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVSKAIRDGAIDATVDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPxxxxxxxxxxxxxxxxxxxxxxxxxxxxEDDDEF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable 26S proteasome non-ATPase regulatory subunit 3a Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.confidentQ9LNU4
Probable 26S proteasome non-ATPase regulatory subunit 3 Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.confidentP93768
Probable 26S proteasome non-ATPase regulatory subunit 3 Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.probableQ06364

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain S
Confidence level:very confident
Coverage over the Query: 180-422
View the alignment between query and template
View the model in PyMOL