Citrus Sinensis ID: 011354
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 488 | ||||||
| 4519264 | 488 | vacuolar H+-ATPase B subunit [Citrus uns | 1.0 | 1.0 | 1.0 | 0.0 | |
| 356575458 | 488 | PREDICTED: V-type proton ATPase subunit | 1.0 | 1.0 | 0.963 | 0.0 | |
| 356536392 | 488 | PREDICTED: V-type proton ATPase subunit | 1.0 | 1.0 | 0.961 | 0.0 | |
| 224105123 | 488 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.956 | 0.0 | |
| 224078391 | 488 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.954 | 0.0 | |
| 357136145 | 488 | PREDICTED: V-type proton ATPase subunit | 1.0 | 1.0 | 0.956 | 0.0 | |
| 255539062 | 488 | ATP synthase subunit beta vacuolar, puta | 1.0 | 1.0 | 0.954 | 0.0 | |
| 326513498 | 488 | predicted protein [Hordeum vulgare subsp | 1.0 | 1.0 | 0.956 | 0.0 | |
| 357507939 | 487 | V-type ATP synthase beta chain [Medicago | 0.997 | 1.0 | 0.961 | 0.0 | |
| 225428086 | 488 | PREDICTED: V-type proton ATPase subunit | 1.0 | 1.0 | 0.956 | 0.0 |
| >gi|4519264|dbj|BAA75517.1| vacuolar H+-ATPase B subunit [Citrus unshiu] | Back alignment and taxonomy information |
|---|
Score = 1000 bits (2586), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 488/488 (100%), Positives = 488/488 (100%)
Query: 1 MGVAQNNVDMEEGTLEVAMEYRTVTGVAGPLVILDKVKGPKYYEIVNIRLGDGTMRRGQV 60
MGVAQNNVDMEEGTLEVAMEYRTVTGVAGPLVILDKVKGPKYYEIVNIRLGDGTMRRGQV
Sbjct: 1 MGVAQNNVDMEEGTLEVAMEYRTVTGVAGPLVILDKVKGPKYYEIVNIRLGDGTMRRGQV 60
Query: 61 LEVDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPIL 120
LEVDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPIL
Sbjct: 61 LEVDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPIL 120
Query: 121 PEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQI 180
PEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQI
Sbjct: 121 PEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQI 180
Query: 181 CRQAGLVKRLEKTDNLLEDGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLN 240
CRQAGLVKRLEKTDNLLEDGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLN
Sbjct: 181 CRQAGLVKRLEKTDNLLEDGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLN 240
Query: 241 LANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRG 300
LANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRG
Sbjct: 241 LANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRG 300
Query: 301 YPGYMYTDLAQIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQ 360
YPGYMYTDLAQIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQ
Sbjct: 301 YPGYMYTDLAQIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQ 360
Query: 361 LQNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHSDVSNQLYANYAIGKDVQAMKAVVGEE 420
LQNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHSDVSNQLYANYAIGKDVQAMKAVVGEE
Sbjct: 361 LQNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHSDVSNQLYANYAIGKDVQAMKAVVGEE 420
Query: 421 ALSSEDLLYLEFLDKFERKFVAQGAYDSRNIFQSLDLAWTLLRIFPRELLHRIPGKTLDQ 480
ALSSEDLLYLEFLDKFERKFVAQGAYDSRNIFQSLDLAWTLLRIFPRELLHRIPGKTLDQ
Sbjct: 421 ALSSEDLLYLEFLDKFERKFVAQGAYDSRNIFQSLDLAWTLLRIFPRELLHRIPGKTLDQ 480
Query: 481 YYSRDAAN 488
YYSRDAAN
Sbjct: 481 YYSRDAAN 488
|
Source: Citrus unshiu Species: Citrus unshiu Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356575458|ref|XP_003555858.1| PREDICTED: V-type proton ATPase subunit B 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356536392|ref|XP_003536722.1| PREDICTED: V-type proton ATPase subunit B 1-like isoform 1 [Glycine max] gi|356536394|ref|XP_003536723.1| PREDICTED: V-type proton ATPase subunit B 1-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224105123|ref|XP_002313695.1| predicted protein [Populus trichocarpa] gi|118484456|gb|ABK94104.1| unknown [Populus trichocarpa] gi|222850103|gb|EEE87650.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224078391|ref|XP_002305533.1| predicted protein [Populus trichocarpa] gi|118488356|gb|ABK95996.1| unknown [Populus trichocarpa] gi|222848497|gb|EEE86044.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357136145|ref|XP_003569666.1| PREDICTED: V-type proton ATPase subunit B2-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|255539062|ref|XP_002510596.1| ATP synthase subunit beta vacuolar, putative [Ricinus communis] gi|223551297|gb|EEF52783.1| ATP synthase subunit beta vacuolar, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|326513498|dbj|BAJ87768.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|357507939|ref|XP_003624258.1| V-type ATP synthase beta chain [Medicago truncatula] gi|355499273|gb|AES80476.1| V-type ATP synthase beta chain [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225428086|ref|XP_002280291.1| PREDICTED: V-type proton ATPase subunit B 1 [Vitis vinifera] gi|297744573|emb|CBI37835.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 488 | ||||||
| TAIR|locus:2012913 | 487 | VAB3 "V-ATPase B subunit 3" [A | 0.995 | 0.997 | 0.944 | 9.9e-245 | |
| TAIR|locus:2204430 | 486 | VAB1 "V-ATPase B subunit 1" [A | 0.989 | 0.993 | 0.952 | 1.6e-244 | |
| FB|FBgn0005671 | 490 | Vha55 "Vacuolar H[+]-ATPase 55 | 0.952 | 0.948 | 0.792 | 5.3e-198 | |
| UNIPROTKB|P21281 | 511 | ATP6V1B2 "V-type proton ATPase | 0.952 | 0.909 | 0.788 | 6.1e-197 | |
| UNIPROTKB|Q5R5V5 | 511 | ATP6V1B2 "V-type proton ATPase | 0.952 | 0.909 | 0.788 | 6.1e-197 | |
| UNIPROTKB|P31408 | 511 | ATP6V1B2 "V-type proton ATPase | 0.952 | 0.909 | 0.786 | 1.3e-196 | |
| UNIPROTKB|F1RMZ8 | 511 | LOC100739134 "Uncharacterized | 0.952 | 0.909 | 0.786 | 1.3e-196 | |
| ZFIN|ZDB-GENE-030711-4 | 509 | atp6v1b2 "ATPase, H+ transport | 0.950 | 0.911 | 0.790 | 1.3e-196 | |
| UNIPROTKB|E2RAC6 | 511 | ATP6V1B2 "Uncharacterized prot | 0.952 | 0.909 | 0.784 | 2.6e-196 | |
| UNIPROTKB|F1NU21 | 512 | ATP6V1B2 "Uncharacterized prot | 0.950 | 0.906 | 0.784 | 5.5e-196 |
| TAIR|locus:2012913 VAB3 "V-ATPase B subunit 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2358 (835.1 bits), Expect = 9.9e-245, P = 9.9e-245
Identities = 460/487 (94%), Positives = 474/487 (97%)
Query: 3 VAQNNVDMEEGTLEVAMEYRTVTGVAGPLVILDKVKGPKYYEIVNIRLGDGTMRRGQVLE 62
+ + ++DMEEGTLE+ MEYRTV+GVAGPLVILDKVKGPKY EIVNIRLGDG+ RRGQVLE
Sbjct: 1 MVETSIDMEEGTLEIGMEYRTVSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLE 60
Query: 63 VDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPE 122
VDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPE
Sbjct: 61 VDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPE 120
Query: 123 AYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICR 182
AYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICR
Sbjct: 121 AYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICR 180
Query: 183 QAGLVKRLEKTDNLL-EDGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNL 241
QAGLVKRLEKT+NL+ ED EDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNL
Sbjct: 181 QAGLVKRLEKTENLIQEDHGEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNL 240
Query: 242 ANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGY 301
ANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGY
Sbjct: 241 ANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGY 300
Query: 302 PGYMYTDLAQIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQL 361
PGYMYTDLA IYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQL
Sbjct: 301 PGYMYTDLATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQL 360
Query: 362 QNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHSDVSNQLYANYAIGKDVQAMKAVVGEEA 421
NRQIYPPINVLPSLSRLMKSAIGEGMTR+DHSDVSNQLYANYAIGKDVQAMKAVVGEEA
Sbjct: 361 HNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHSDVSNQLYANYAIGKDVQAMKAVVGEEA 420
Query: 422 LSSEDLLYLEFLDKFERKFVAQGAYDSRNIFQSLDLAWTLLRIFPRELLHRIPGKTLDQY 481
LSSEDLLYLEFLDKFERKFV QGAYD+RNIFQSLDLAWTLLRIFPRELLHRIP KTLDQ+
Sbjct: 421 LSSEDLLYLEFLDKFERKFVMQGAYDTRNIFQSLDLAWTLLRIFPRELLHRIPAKTLDQF 480
Query: 482 YSRDAAN 488
YSRD+ +
Sbjct: 481 YSRDSTS 487
|
|
| TAIR|locus:2204430 VAB1 "V-ATPase B subunit 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0005671 Vha55 "Vacuolar H[+]-ATPase 55kD subunit" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P21281 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R5V5 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P31408 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RMZ8 LOC100739134 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030711-4 atp6v1b2 "ATPase, H+ transporting, lysosomal V1 subunit B2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RAC6 ATP6V1B2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NU21 ATP6V1B2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 488 | |||
| TIGR01040 | 466 | TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B | 0.0 | |
| PRK04196 | 460 | PRK04196, PRK04196, V-type ATP synthase subunit B; | 0.0 | |
| COG1156 | 463 | COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su | 0.0 | |
| TIGR01041 | 458 | TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, | 0.0 | |
| cd01135 | 276 | cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- | 0.0 | |
| PRK02118 | 436 | PRK02118, PRK02118, V-type ATP synthase subunit B; | 1e-120 | |
| pfam00006 | 213 | pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa | 2e-86 | |
| COG1157 | 441 | COG1157, FliI, Flagellar biosynthesis/type III sec | 1e-54 | |
| TIGR01026 | 440 | TIGR01026, fliI_yscN, ATPase FliI/YscN family | 1e-46 | |
| TIGR02546 | 422 | TIGR02546, III_secr_ATP, type III secretion appara | 7e-44 | |
| TIGR03498 | 418 | TIGR03498, FliI_clade3, flagellar protein export A | 8e-41 | |
| cd01136 | 326 | cd01136, ATPase_flagellum-secretory_path_III, Flag | 1e-39 | |
| TIGR03497 | 413 | TIGR03497, FliI_clade2, flagellar protein export A | 2e-39 | |
| PRK06936 | 439 | PRK06936, PRK06936, type III secretion system ATPa | 4e-38 | |
| TIGR00962 | 501 | TIGR00962, atpA, proton translocating ATP synthase | 1e-36 | |
| COG0056 | 504 | COG0056, AtpA, F0F1-type ATP synthase, alpha subun | 1e-35 | |
| TIGR01039 | 461 | TIGR01039, atpD, ATP synthase, F1 beta subunit | 6e-33 | |
| PRK06820 | 440 | PRK06820, PRK06820, type III secretion system ATPa | 6e-33 | |
| PRK12597 | 461 | PRK12597, PRK12597, F0F1 ATP synthase subunit beta | 4e-32 | |
| PRK08472 | 434 | PRK08472, fliI, flagellum-specific ATP synthase; V | 2e-31 | |
| cd01132 | 274 | cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c | 5e-31 | |
| PRK06315 | 442 | PRK06315, PRK06315, type III secretion system ATPa | 8e-31 | |
| PRK05688 | 451 | PRK05688, fliI, flagellum-specific ATP synthase; V | 1e-30 | |
| TIGR03305 | 449 | TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, | 9e-30 | |
| PRK09099 | 441 | PRK09099, PRK09099, type III secretion system ATPa | 1e-29 | |
| PRK13343 | 502 | PRK13343, PRK13343, F0F1 ATP synthase subunit alph | 5e-29 | |
| COG0055 | 468 | COG0055, AtpD, F0F1-type ATP synthase, beta subuni | 7e-29 | |
| PRK07594 | 433 | PRK07594, PRK07594, type III secretion system ATPa | 5e-28 | |
| cd01133 | 274 | cd01133, F1-ATPase_beta, F1 ATP synthase beta subu | 2e-27 | |
| PRK06002 | 450 | PRK06002, fliI, flagellum-specific ATP synthase; V | 7e-27 | |
| PRK07721 | 438 | PRK07721, fliI, flagellum-specific ATP synthase; V | 7e-27 | |
| PRK06793 | 432 | PRK06793, fliI, flagellum-specific ATP synthase; V | 9e-27 | |
| PRK08149 | 428 | PRK08149, PRK08149, ATP synthase SpaL; Validated | 6e-26 | |
| CHL00059 | 485 | CHL00059, atpA, ATP synthase CF1 alpha subunit | 7e-26 | |
| PRK08972 | 444 | PRK08972, fliI, flagellum-specific ATP synthase; V | 2e-25 | |
| PRK07960 | 455 | PRK07960, fliI, flagellum-specific ATP synthase; V | 9e-25 | |
| PRK07196 | 434 | PRK07196, fliI, flagellum-specific ATP synthase; V | 3e-24 | |
| TIGR03324 | 497 | TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, | 3e-23 | |
| PRK05922 | 434 | PRK05922, PRK05922, type III secretion system ATPa | 6e-23 | |
| PRK09280 | 463 | PRK09280, PRK09280, F0F1 ATP synthase subunit beta | 3e-22 | |
| PTZ00185 | 574 | PTZ00185, PTZ00185, ATPase alpha subunit; Provisio | 6e-22 | |
| TIGR03496 | 411 | TIGR03496, FliI_clade1, flagellar protein export A | 1e-21 | |
| COG1155 | 588 | COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su | 2e-21 | |
| PRK08927 | 442 | PRK08927, fliI, flagellum-specific ATP synthase; V | 1e-20 | |
| TIGR01043 | 578 | TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, | 2e-19 | |
| TIGR03496 | 411 | TIGR03496, FliI_clade1, flagellar protein export A | 3e-19 | |
| PRK14698 | 1017 | PRK14698, PRK14698, V-type ATP synthase subunit A; | 4e-19 | |
| TIGR01042 | 591 | TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A | 1e-18 | |
| pfam00306 | 110 | pfam00306, ATP-synt_ab_C, ATP synthase alpha/beta | 2e-18 | |
| cd01120 | 165 | cd01120, RecA-like_NTPases, RecA-like NTPases | 2e-18 | |
| PRK07165 | 507 | PRK07165, PRK07165, F0F1 ATP synthase subunit alph | 9e-18 | |
| cd01134 | 369 | cd01134, V_A-ATPase_A, V/A-type ATP synthase catal | 3e-17 | |
| CHL00060 | 494 | CHL00060, atpB, ATP synthase CF1 beta subunit | 4e-16 | |
| PRK04192 | 586 | PRK04192, PRK04192, V-type ATP synthase subunit A; | 5e-15 | |
| PRK09281 | 502 | PRK09281, PRK09281, F0F1 ATP synthase subunit alph | 9e-13 | |
| pfam02874 | 69 | pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta | 5e-11 | |
| PRK04192 | 586 | PRK04192, PRK04192, V-type ATP synthase subunit A; | 6e-11 | |
| COG1155 | 588 | COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su | 5e-09 | |
| PRK09281 | 502 | PRK09281, PRK09281, F0F1 ATP synthase subunit alph | 5e-09 | |
| TIGR01043 | 578 | TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, | 6e-09 | |
| TIGR01042 | 591 | TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A | 3e-08 | |
| PRK14698 | 1017 | PRK14698, PRK14698, V-type ATP synthase subunit A; | 8e-08 |
| >gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
Score = 979 bits (2532), Expect = 0.0
Identities = 387/468 (82%), Positives = 421/468 (89%), Gaps = 3/468 (0%)
Query: 20 EYRTVTGVAGPLVILDKVKGPKYYEIVNIRLGDGTMRRGQVLEVDGEKAVVQVFEGTSGI 79
EYRTV+GV GPLVILD VK P++ EIVN+ L DGT+R GQVLEV G KAVVQVFEGTSGI
Sbjct: 1 EYRTVSGVNGPLVILDNVKFPRFAEIVNLTLPDGTVRSGQVLEVSGNKAVVQVFEGTSGI 60
Query: 80 DNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTY 139
D K TT +FTG++L+TPVS DMLGR+FNGSGKPID GPP+L E YLDI+G INP R Y
Sbjct: 61 DAKKTTCEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPVLAEDYLDINGQPINPYARIY 120
Query: 140 PEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICRQAGLVKRLEKTDNLLED 199
PEEMIQTGIS IDVMNSIARGQKIP+FSAAGLPHNEIAAQICRQAGLVK K + D
Sbjct: 121 PEEMIQTGISAIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKLPTKD---VHD 177
Query: 200 GEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERIITPRIALTT 259
G EDNFAIVFAAMGVNMETA+FFK+DFEENGSMERV LFLNLANDPTIERIITPR+ALTT
Sbjct: 178 GHEDNFAIVFAAMGVNMETARFFKQDFEENGSMERVCLFLNLANDPTIERIITPRLALTT 237
Query: 260 AEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLAQIYERAGRI 319
AEYLAY+C KHVLVILTDMSSYADALREVSAAREEVPGRRG+PGYMYTDLA IYERAGR+
Sbjct: 238 AEYLAYQCEKHVLVILTDMSSYADALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRV 297
Query: 320 EGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLQNRQIYPPINVLPSLSRL 379
EGR GSITQIPILTMPNDDITHP PDLTGYITEGQIY+DRQL NRQIYPPINVLPSLSRL
Sbjct: 298 EGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRL 357
Query: 380 MKSAIGEGMTRRDHSDVSNQLYANYAIGKDVQAMKAVVGEEALSSEDLLYLEFLDKFERK 439
MKSAIGEGMTR+DHSDVSNQLYA YAIGKDVQAMKAVVGEEALSSEDLLYLEFLDKFE+
Sbjct: 358 MKSAIGEGMTRKDHSDVSNQLYACYAIGKDVQAMKAVVGEEALSSEDLLYLEFLDKFEKN 417
Query: 440 FVAQGAYDSRNIFQSLDLAWTLLRIFPRELLHRIPGKTLDQYYSRDAA 487
F+AQG Y++R IF+SLD+AW LLRIFP+E+L RIP K L+++Y R +A
Sbjct: 418 FIAQGPYENRTIFESLDIAWQLLRIFPKEMLKRIPAKILEEFYPRKSA 465
|
This models eukaryotic vacuolar (H+)-ATPase that is responsible for acidifying cellular compartments. This enzyme shares extensive sequence similarity with archaeal ATP synthase [Transport and binding proteins, Cations and iron carrying compounds]. Length = 466 |
| >gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238553 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235666 PRK06002, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|215848 pfam00306, ATP-synt_ab_C, ATP synthase alpha/beta chain, C terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases | Back alignment and domain information |
|---|
| >gnl|CDD|235951 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238554 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|214349 CHL00060, atpB, ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217261 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain | Back alignment and domain information |
|---|
| >gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 488 | |||
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 100.0 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 100.0 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 100.0 | |
| COG1157 | 441 | FliI Flagellar biosynthesis/type III secretory pat | 100.0 | |
| PRK02118 | 436 | V-type ATP synthase subunit B; Provisional | 100.0 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 100.0 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 100.0 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 100.0 | |
| TIGR01043 | 578 | ATP_syn_A_arch ATP synthase archaeal, A subunit. A | 100.0 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 100.0 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 100.0 | |
| PRK04192 | 586 | V-type ATP synthase subunit A; Provisional | 100.0 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 100.0 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 100.0 | |
| PRK13343 | 502 | F0F1 ATP synthase subunit alpha; Provisional | 100.0 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| TIGR00962 | 501 | atpA proton translocating ATP synthase, F1 alpha s | 100.0 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 100.0 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 100.0 | |
| TIGR01042 | 591 | V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th | 100.0 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK07165 | 507 | F0F1 ATP synthase subunit alpha; Validated | 100.0 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 100.0 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 100.0 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 100.0 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 100.0 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 100.0 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 100.0 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 100.0 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 100.0 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 100.0 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| COG1156 | 463 | NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E | 100.0 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 100.0 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 100.0 | |
| KOG1351 | 489 | consensus Vacuolar H+-ATPase V1 sector, subunit B | 100.0 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK06315 | 442 | type III secretion system ATPase; Provisional | 100.0 | |
| COG0055 | 468 | AtpD F0F1-type ATP synthase, beta subunit [Energy | 100.0 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 100.0 | |
| COG0056 | 504 | AtpA F0F1-type ATP synthase, alpha subunit [Energy | 100.0 | |
| PRK14698 | 1017 | V-type ATP synthase subunit A; Provisional | 100.0 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 100.0 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 100.0 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 100.0 | |
| KOG1350 | 521 | consensus F0F1-type ATP synthase, beta subunit [En | 100.0 | |
| COG1155 | 588 | NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E | 100.0 | |
| KOG1352 | 618 | consensus Vacuolar H+-ATPase V1 sector, subunit A | 100.0 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 100.0 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 100.0 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 100.0 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 100.0 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 100.0 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 100.0 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 100.0 | |
| KOG1353 | 340 | consensus F0F1-type ATP synthase, alpha subunit [E | 100.0 | |
| COG1158 | 422 | Rho Transcription termination factor [Transcriptio | 100.0 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 99.07 | |
| PF00306 | 113 | ATP-synt_ab_C: ATP synthase alpha/beta chain, C te | 98.86 | |
| PF02874 | 69 | ATP-synt_ab_N: ATP synthase alpha/beta family, bet | 98.8 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 97.78 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 97.62 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.59 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 97.56 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.47 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 97.29 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.23 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.01 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 96.98 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 96.98 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 96.96 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 96.95 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 96.94 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 96.89 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 96.84 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 96.75 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 96.73 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 96.71 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 96.6 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 96.53 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 96.45 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 96.4 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 96.37 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 96.35 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 96.29 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 96.28 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 96.2 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 96.08 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.05 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 96.01 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 95.97 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 95.9 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 95.81 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 95.78 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 95.72 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 95.67 | |
| COG1155 | 588 | NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E | 95.64 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 95.51 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 95.39 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 95.29 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 95.26 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 95.25 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 95.13 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 95.05 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 95.03 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 94.99 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 94.96 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 94.91 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 94.87 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 94.81 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 94.8 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 94.79 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 94.75 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 94.73 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 94.71 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 94.7 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.68 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 94.67 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 94.66 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 94.65 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 94.65 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 94.65 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 94.59 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 94.58 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 94.55 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 94.55 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 94.54 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 94.53 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 94.52 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 94.51 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 94.47 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 94.47 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 94.47 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 94.46 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 94.46 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 94.45 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 94.44 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 94.43 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 94.43 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 94.43 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 94.41 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 94.41 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 94.4 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 94.39 | |
| PF13173 | 128 | AAA_14: AAA domain | 94.38 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 94.37 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 94.35 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 94.33 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 94.33 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 94.33 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 94.33 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 94.31 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 94.31 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 94.3 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 94.3 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 94.29 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 94.29 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 94.27 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 94.25 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 94.25 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 94.24 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 94.23 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 94.23 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 94.23 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 94.21 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 94.19 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 94.18 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 94.18 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 94.17 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 94.15 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 94.15 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 94.15 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 94.14 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 94.14 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 94.13 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 94.12 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 94.12 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 94.12 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 94.12 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 94.11 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 94.11 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 94.09 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 94.09 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 94.08 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 94.07 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 94.06 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 94.05 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 94.05 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 94.04 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 94.04 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 94.03 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 94.03 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 94.0 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 93.99 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 93.98 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 93.97 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 93.97 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 93.97 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 93.95 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 93.95 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 93.94 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 93.92 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 93.91 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 93.91 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 93.9 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 93.9 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 93.9 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 93.88 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 93.88 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 93.88 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 93.86 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 93.86 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 93.86 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 93.86 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 93.85 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 93.82 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.81 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 93.8 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 93.8 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 93.79 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 93.79 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 93.78 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 93.77 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 93.77 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 93.77 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 93.76 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.76 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.76 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 93.75 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.74 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.73 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 93.72 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 93.72 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 93.71 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 93.71 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 93.71 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 93.7 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.69 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 93.69 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 93.69 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 93.69 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 93.67 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 93.67 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.66 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 93.65 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 93.64 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 93.64 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 93.63 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 93.63 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 93.63 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 93.62 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 93.62 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 93.6 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 93.59 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 93.59 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 93.57 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 93.57 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 93.55 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 93.54 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 93.54 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 93.54 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 93.54 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 93.54 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 93.53 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.53 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 93.53 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.52 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 93.5 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 93.5 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 93.49 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.48 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 93.47 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 93.45 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 93.42 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 93.42 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 93.4 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 93.38 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 93.37 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 93.36 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 93.35 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 93.34 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 93.32 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.32 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 93.28 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 93.27 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.27 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.26 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 93.26 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 93.24 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 93.23 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 93.22 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 93.22 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 93.21 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 93.2 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 93.19 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 93.17 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 93.17 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 93.15 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 93.15 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 93.15 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 93.13 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 93.13 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.13 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.13 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 93.11 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 93.11 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 93.11 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 93.1 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 93.07 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 93.06 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 93.06 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 93.06 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.05 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 93.04 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 93.04 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 93.01 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 92.97 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 92.96 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 92.94 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 92.92 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.89 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.89 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 92.85 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 92.83 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.82 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 92.82 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 92.8 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 92.79 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 92.78 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 92.73 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 92.72 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 92.71 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 92.69 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.68 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 92.68 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 92.68 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.65 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 92.65 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 92.65 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 92.65 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 92.64 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 92.64 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.62 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 92.61 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.58 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.48 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 92.48 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 92.46 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 92.44 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 92.43 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 92.42 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 92.4 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 92.32 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 92.3 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 92.23 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 92.22 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 92.2 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 92.19 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 92.12 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 92.03 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 91.99 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 91.99 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 91.9 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 91.89 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 91.85 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 91.8 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 91.79 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 91.72 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 91.64 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 91.61 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 91.55 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 91.54 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 91.5 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 91.4 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 91.38 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 91.37 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 91.34 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 91.33 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 91.3 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 91.3 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 91.29 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 91.2 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 91.19 | |
| PRK12377 | 248 | putative replication protein; Provisional | 91.18 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 91.18 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 91.16 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 91.16 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 91.09 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 91.08 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 91.05 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 91.05 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 91.04 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 91.03 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 90.98 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 90.97 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 90.97 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 90.96 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 90.93 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 90.93 | |
| PRK08181 | 269 | transposase; Validated | 90.91 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 90.89 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 90.88 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 90.88 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 90.87 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 90.87 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 90.85 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 90.82 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 90.77 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 90.75 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 90.75 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 90.73 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 90.71 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 90.71 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 90.67 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 90.66 | |
| PRK06217 | 183 | hypothetical protein; Validated | 90.63 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 90.59 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 90.56 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 90.56 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 90.55 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 90.53 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 90.4 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 90.36 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 90.35 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 90.35 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 90.34 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 90.2 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 90.11 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 90.07 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 90.07 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 90.05 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 90.02 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 90.01 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 89.93 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 89.93 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 89.8 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 89.77 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 89.74 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 89.71 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 89.7 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 89.53 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 89.42 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 89.38 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 89.36 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 89.36 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 89.29 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 89.25 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 89.24 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 89.21 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 89.16 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 89.13 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 89.13 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 89.09 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 89.07 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 89.05 | |
| PRK03839 | 180 | putative kinase; Provisional | 89.05 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 89.04 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 89.03 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 88.96 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 88.94 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 88.92 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 88.91 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 88.81 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 88.81 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 88.68 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 88.66 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 88.62 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 88.6 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 88.54 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 88.47 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 88.45 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 88.44 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 88.41 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 88.31 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 88.27 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 88.24 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 88.24 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 88.2 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 88.2 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 88.17 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 88.17 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 88.1 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 88.07 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 88.02 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 87.9 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 87.73 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 87.71 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 87.71 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 87.68 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 87.6 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 87.59 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 87.57 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 87.55 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 87.51 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 87.43 |
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
Probab=100.00 E-value=5e-126 Score=992.81 Aligned_cols=465 Identities=83% Similarity=1.288 Sum_probs=440.9
Q ss_pred eeeEEEEEECCEEEEeccCCCCCCcEEEEEeCCCceeEEEEEEEECCeEEEEEccCCCCCccCCCEEEEcCCeeeEecCc
Q 011354 20 EYRTVTGVAGPLVILDKVKGPKYYEIVNIRLGDGTMRRGQVLEVDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVSL 99 (488)
Q Consensus 20 ~~G~V~~I~G~li~v~g~~~~~igE~~~i~~~~g~~~~geVv~~~~~~~~l~~~~~t~Gl~~~G~~V~~tg~~~~VpvG~ 99 (488)
+|++|++|.|+++++.|++.+++||+|+|...+|....|||++|+++.+++|||++++||+.+|++|.+||++++||||+
T Consensus 1 ~y~~v~~i~G~~i~~~g~~~~~~Ge~~~i~~~~~~~~~geVi~~~~~~~~l~~~~~~~gi~~~g~~V~~t~~~~~v~vg~ 80 (466)
T TIGR01040 1 EYRTVSGVNGPLVILDNVKFPRFAEIVNLTLPDGTVRSGQVLEVSGNKAVVQVFEGTSGIDAKKTTCEFTGDILRTPVSE 80 (466)
T ss_pred CCccceEEEccEEEEECCCCCCcCCEEEEEeCCCCEEEEEEEEEeCCeEEEEEcCCCCCcccCCCEEEECCCccEEEcCc
Confidence 47899999999999999978999999999644565578999999999999999999999986699999999999999999
Q ss_pred cccceEecCCCcccCCCCCCCCCceeeccCCCCCCCCCCCcccceecceeeeeeeeecccCcEEEeccCCCCChhHHHHH
Q 011354 100 DMLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQ 179 (488)
Q Consensus 100 ~lLGRVlD~lG~PlDg~~~~~~~~~~~i~~~~~~~~~R~~~~~~l~TGI~aID~l~pig~Gqr~gIfg~~G~GKt~Ll~~ 179 (488)
+|||||+|++|+|||+.+++....++++++.||+|++|.++++||+||||+||+|+|||+|||+||||++|+|||+|++|
T Consensus 81 ~lLGRVid~~G~piD~~~~~~~~~~~~i~~~~~~~~~R~~i~e~l~TGI~aID~l~~ig~GQRigIfagsGvGKs~L~~~ 160 (466)
T TIGR01040 81 DMLGRVFNGSGKPIDKGPPVLAEDYLDINGQPINPYARIYPEEMIQTGISAIDVMNSIARGQKIPIFSAAGLPHNEIAAQ 160 (466)
T ss_pred ccccCEECccccccCCCCCCCCCceeeccCCCCChhHcCCCCCeeecCcEEEeccCccccCCeeeeecCCCCCHHHHHHH
Confidence 99999999999999999888777788999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhcccccccccccccccCCCCCeEEEEEEecCchHHHHHHHHhhccCCCcceEEEEEeCCCCCHHHHHhHHHHHHHH
Q 011354 180 ICRQAGLVKRLEKTDNLLEDGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERIITPRIALTT 259 (488)
Q Consensus 180 i~~~~~~~~~~~~~d~~~~~~~~~~~~~V~~~iGer~e~~~~~~~~l~~~~~~~~tvvv~~t~~~~~~~r~~a~~~a~ti 259 (488)
|++|+..... ..|| +..|++++++|||++||||+|+.+|++++|+++|+++||++|++|+|+||++|++++|+|+|+
T Consensus 161 i~~~~~~~~~-~~aD--~~~~~~~~~v~V~a~IGerre~~efi~~~l~~~g~l~rtvvv~atsd~p~~~R~~a~~~a~ti 237 (466)
T TIGR01040 161 ICRQAGLVKL-PTKD--VHDGHEDNFAIVFAAMGVNMETARFFKQDFEENGSMERVCLFLNLANDPTIERIITPRLALTT 237 (466)
T ss_pred HHHhhccccc-cccc--cccccCCceEEEEEEeeeehHHHHHHHHHHHhcCCcceEEEEEECCCCCHHHHHHHHhhhHHH
Confidence 9999863210 0145 456677778999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhhHhcCCeEEEEEcchhhHHHHHHHHHHhcCCCCCCCCCCCchhhhHHHHHHhhcccCCCCcceeEEeEEeecCCCC
Q 011354 260 AEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLAQIYERAGRIEGRKGSITQIPILTMPNDDI 339 (488)
Q Consensus 260 AEyfr~d~G~~Vlli~Dsltr~a~A~rEisl~~ge~p~~~gyp~~lfs~l~~l~ERag~~~~~~GSIT~i~~v~~~~dD~ 339 (488)
|||||+++|+||||++||+||||+|+||||+++||||+++|||||||+.||+|+||||++++++||||+||+|++|+||+
T Consensus 238 AEyfr~~~G~~VLl~~DslTr~A~A~REisl~~gepP~~~GYP~svfs~l~~L~ERaG~~~~~~GSITai~tV~~~~dD~ 317 (466)
T TIGR01040 238 AEYLAYQCEKHVLVILTDMSSYADALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDI 317 (466)
T ss_pred HHHHHHhcCCcEEEeccChHHHHHHHHHHHHhcCCCCCCcCcCchHHHHHHHHhhccccCCCCCcceEEEEEEECCCCCC
Confidence 99999889999999999999999999999999999999999999999999999999999754589999999999999999
Q ss_pred CCCcccccccccceEEEeeccccccCCCCCCcCCCCcccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHhCC
Q 011354 340 THPTPDLTGYITEGQIYIDRQLQNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHSDVSNQLYANYAIGKDVQAMKAVVGE 419 (488)
Q Consensus 340 ~dpi~d~~~~i~Dg~ivLsr~La~~g~yPAID~l~S~SR~~~~~~~~~~~~~~h~~~~~~l~~~y~~~~~l~~~~~~~G~ 419 (488)
+|||+|+++|||||||||||+||++||||||||+.|+||+|+.++++++++++|+++++++++.|+++++|+++++|.|.
T Consensus 318 ~~pI~d~~~sIlDGhIvLsr~La~~g~yPAIDvl~SvSRl~~~v~~~~~~~~~h~~~a~~l~~~y~~~~~L~~ig~y~G~ 397 (466)
T TIGR01040 318 THPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHSDVSNQLYACYAIGKDVQAMKAVVGE 397 (466)
T ss_pred CCcchhhhhhhcceEEEECHHHHhCCCCCccCCccchhhccccccccCcCcHHHHHHHHHHHHHHHHHHHHHHHHHhcCC
Confidence 99999999999999999999999999999999999999999999998898899999999999999999999999999999
Q ss_pred cCCCHHHHHHHHHHhHHHHHHhccCCCCCCCHHHHHHHHHHHHHhcchhhhcCCChhhHhhhcccccc
Q 011354 420 EALSSEDLLYLEFLDKFERKFVAQGAYDSRNIFQSLDLAWTLLRIFPRELLHRIPGKTLDQYYSRDAA 487 (488)
Q Consensus 420 d~l~~~~~~~l~~~~~i~~~fL~Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 487 (488)
|+++|++...+.+++.|++.||+|++++..+++++++..|++++.+|++++++||+++|++||+++.|
T Consensus 398 d~l~d~a~~~l~~~~~i~~~FL~Q~~~~~~~~~~~l~~~w~ll~~~~~~~~~r~~~~~~~~~~~~~~~ 465 (466)
T TIGR01040 398 EALSSEDLLYLEFLDKFEKNFIAQGPYENRTIFESLDIAWQLLRIFPKEMLKRIPAKILEEFYPRKSA 465 (466)
T ss_pred CcCCHHHHHHHHHHHHHHHHHhccCcCCCcCHHHHHHHHHHHHHhCCHHHhccCCHHHHHHhcccccC
Confidence 99999999999999999779999999999999999999999999999999999999999999998765
|
This models eukaryotic vacuolar (H+)-ATPase that is responsible for acidifying cellular compartments. This enzyme shares extensive sequence similarity with archaeal ATP synthase. |
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK02118 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PRK04192 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK13343 F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK07165 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >KOG1351 consensus Vacuolar H+-ATPase V1 sector, subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06315 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14698 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >KOG1350 consensus F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1352 consensus Vacuolar H+-ATPase V1 sector, subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >KOG1353 consensus F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1158 Rho Transcription termination factor [Transcription] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF00306 ATP-synt_ab_C: ATP synthase alpha/beta chain, C terminal domain; InterPro: IPR000793 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 488 | ||||
| 2c61_A | 469 | Crystal Structure Of The Non-Catalytic B Subunit Of | 1e-161 | ||
| 2rkw_A | 469 | Intermediate Position Of Atp On Its Trail To The Bi | 1e-160 | ||
| 3ssa_A | 460 | Crystal Structure Of Subunit B Mutant N157t Of The | 1e-160 | ||
| 3tiv_A | 460 | Crystal Structure Of Subunit B Mutant N157a Of The | 1e-160 | ||
| 3tgw_A | 460 | Crystal Structure Of Subunit B Mutant H156a Of The | 1e-159 | ||
| 3vr6_D | 465 | Crystal Structure Of Amp-pnp Bound Enterococcus Hir | 1e-158 | ||
| 3gqb_B | 464 | Crystal Structure Of The A3b3 Complex From V-atpase | 1e-149 | ||
| 3a5c_D | 478 | Inter-Subunit Interaction And Quaternary Rearrangem | 1e-149 | ||
| 3vr2_D | 465 | Crystal Structure Of Nucleotide-free A3b3 Complex F | 1e-148 | ||
| 4b2q_E | 473 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 2e-31 | ||
| 3oeh_D | 484 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 2e-31 | ||
| 3fks_D | 484 | Yeast F1 Atpase In The Absence Of Bound Nucleotides | 2e-31 | ||
| 2hld_D | 478 | Crystal Structure Of Yeast Mitochondrial F1-Atpase | 2e-31 | ||
| 4b2q_D | 470 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 2e-31 | ||
| 2xok_D | 511 | Refined Structure Of Yeast F1c10 Atpase Complex To | 2e-31 | ||
| 2qe7_D | 462 | Crystal Structure Of The F1-Atpase From The Thermoa | 6e-30 | ||
| 1mab_B | 479 | Rat Liver F1-Atpase Length = 479 | 3e-28 | ||
| 1fx0_A | 507 | Crystal Structure Of The Chloroplast F1-Atpase From | 4e-28 | ||
| 1nbm_E | 480 | The Structure Of Bovine F1-Atpase Covalently Inhibi | 4e-28 | ||
| 2xnd_D | 467 | Crystal Structure Of Bovine F1-C8 Sub-Complex Of At | 5e-28 | ||
| 1nbm_D | 480 | The Structure Of Bovine F1-Atpase Covalently Inhibi | 7e-28 | ||
| 1cow_D | 482 | Bovine Mitochondrial F1-Atpase Complexed With Aurov | 7e-28 | ||
| 4asu_D | 480 | F1-Atpase In Which All Three Catalytic Sites Contai | 7e-28 | ||
| 2w6e_D | 528 | Low Resolution Structures Of Bovine Mitochondrial F | 8e-28 | ||
| 2qe7_A | 502 | Crystal Structure Of The F1-Atpase From The Thermoa | 3e-27 | ||
| 1sky_E | 473 | Crystal Structure Of The Nucleotide Free Alpha3beta | 1e-26 | ||
| 3oaa_D | 459 | Structure Of The E.Coli F1-Atp Synthase Inhibited B | 1e-25 | ||
| 3oaa_A | 513 | Structure Of The E.Coli F1-Atp Synthase Inhibited B | 2e-25 | ||
| 2dpy_A | 438 | Crystal Structure Of The Flagellar Type Iii Atpase | 3e-24 | ||
| 1sky_B | 502 | Crystal Structure Of The Nucleotide Free Alpha3beta | 4e-24 | ||
| 2r9v_A | 515 | Crystal Structure Of Atp Synthase Subunit Alpha (Tm | 6e-24 | ||
| 4b2q_B | 486 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 6e-24 | ||
| 4b2q_A | 485 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 6e-24 | ||
| 3ofn_A | 510 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 6e-24 | ||
| 3vr6_A | 600 | Crystal Structure Of Amp-pnp Bound Enterococcus Hir | 7e-24 | ||
| 2hld_A | 510 | Crystal Structure Of Yeast Mitochondrial F1-Atpase | 7e-24 | ||
| 3oee_A | 510 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 7e-24 | ||
| 2xok_A | 545 | Refined Structure Of Yeast F1c10 Atpase Complex To | 8e-24 | ||
| 2xnd_A | 492 | Crystal Structure Of Bovine F1-C8 Sub-Complex Of At | 1e-23 | ||
| 1ohh_B | 487 | Bovine Mitochondrial F1-Atpase Complexed With The I | 1e-23 | ||
| 1bmf_A | 510 | Bovine Mitochondrial F1-Atpase Length = 510 | 2e-23 | ||
| 2jiz_A | 510 | The Structure Of F1-Atpase Inhibited By Resveratrol | 2e-23 | ||
| 1cow_A | 510 | Bovine Mitochondrial F1-Atpase Complexed With Aurov | 2e-23 | ||
| 2w6e_A | 553 | Low Resolution Structures Of Bovine Mitochondrial F | 2e-23 | ||
| 1fx0_B | 498 | Crystal Structure Of The Chloroplast F1-Atpase From | 5e-23 | ||
| 2f43_A | 510 | Rat Liver F1-atpase Length = 510 | 1e-22 | ||
| 1mab_A | 510 | Rat Liver F1-Atpase Length = 510 | 1e-22 | ||
| 3vr2_A | 600 | Crystal Structure Of Nucleotide-free A3b3 Complex F | 1e-21 | ||
| 2obl_A | 347 | Structural And Biochemical Analysis Of A Prototypic | 3e-20 | ||
| 3nd8_A | 588 | Structural Characterization For The Nucleotide Bind | 6e-20 | ||
| 3qg1_A | 588 | Crystal Structure Of P-Loop G239a Mutant Of Subunit | 8e-20 | ||
| 3se0_A | 588 | Structural Characterization Of The Subunit A Mutant | 8e-20 | ||
| 3sdz_A | 588 | Structural Characterization Of The Subunit A Mutant | 8e-20 | ||
| 1vdz_A | 588 | Crystal Structure Of A-Type Atpase Catalytic Subuni | 9e-20 | ||
| 3nd9_A | 588 | Structural Characterization For The Nucleotide Bind | 1e-19 | ||
| 3m4y_A | 588 | Structural Characterization Of The Subunit A Mutant | 1e-19 | ||
| 3qjy_A | 588 | Crystal Structure Of P-Loop G234a Mutant Of Subunit | 1e-19 | ||
| 3qia_A | 588 | Crystal Structure Of P-Loop G237a Mutant Of Subunit | 1e-19 | ||
| 3i4l_A | 588 | Structural Characterization For The Nucleotide Bind | 1e-19 | ||
| 3ikj_A | 588 | Structural Characterization For The Nucleotide Bind | 1e-19 | ||
| 3mfy_A | 588 | Structural Characterization Of The Subunit A Mutant | 1e-19 | ||
| 3gqb_A | 578 | Crystal Structure Of The A3b3 Complex From V-atpase | 7e-19 | ||
| 3a5c_A | 578 | Inter-Subunit Interaction And Quaternary Rearrangem | 1e-18 |
| >pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 | Back alignment and structure |
|
| >pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 | Back alignment and structure |
| >pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 | Back alignment and structure |
| >pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 | Back alignment and structure |
| >pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 | Back alignment and structure |
| >pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 | Back alignment and structure |
| >pdb|4B2Q|E Chain E, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 473 | Back alignment and structure |
| >pdb|3OEH|D Chain D, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f Length = 484 | Back alignment and structure |
| >pdb|3FKS|D Chain D, Yeast F1 Atpase In The Absence Of Bound Nucleotides Length = 484 | Back alignment and structure |
| >pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 478 | Back alignment and structure |
| >pdb|4B2Q|D Chain D, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 470 | Back alignment and structure |
| >pdb|2XOK|D Chain D, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 511 | Back alignment and structure |
| >pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 462 | Back alignment and structure |
| >pdb|1MAB|B Chain B, Rat Liver F1-Atpase Length = 479 | Back alignment and structure |
| >pdb|1FX0|A Chain A, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 507 | Back alignment and structure |
| >pdb|1NBM|E Chain E, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 | Back alignment and structure |
| >pdb|2XND|D Chain D, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 467 | Back alignment and structure |
| >pdb|1NBM|D Chain D, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 | Back alignment and structure |
| >pdb|1COW|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 482 | Back alignment and structure |
| >pdb|4ASU|D Chain D, F1-Atpase In Which All Three Catalytic Sites Contain Bound Nucleotide, With Magnesium Ion Released In The Empty Site Length = 480 | Back alignment and structure |
| >pdb|2W6E|D Chain D, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 528 | Back alignment and structure |
| >pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 502 | Back alignment and structure |
| >pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 473 | Back alignment and structure |
| >pdb|3OAA|D Chain D, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 459 | Back alignment and structure |
| >pdb|3OAA|A Chain A, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 513 | Back alignment and structure |
| >pdb|2DPY|A Chain A, Crystal Structure Of The Flagellar Type Iii Atpase Flii Length = 438 | Back alignment and structure |
| >pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 502 | Back alignment and structure |
| >pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution Length = 515 | Back alignment and structure |
| >pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 | Back alignment and structure |
| >pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 | Back alignment and structure |
| >pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 | Back alignment and structure |
| >pdb|3VR6|A Chain A, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 600 | Back alignment and structure |
| >pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 | Back alignment and structure |
| >pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 | Back alignment and structure |
| >pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 | Back alignment and structure |
| >pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 | Back alignment and structure |
| >pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 | Back alignment and structure |
| >pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 | Back alignment and structure |
| >pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 | Back alignment and structure |
| >pdb|1FX0|B Chain B, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 498 | Back alignment and structure |
| >pdb|2F43|A Chain A, Rat Liver F1-atpase Length = 510 | Back alignment and structure |
| >pdb|1MAB|A Chain A, Rat Liver F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|3VR2|A Chain A, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 600 | Back alignment and structure |
| >pdb|2OBL|A Chain A, Structural And Biochemical Analysis Of A Prototypical Atpase From The Type Iii Secretion System Of Pathogenic Bacteria Length = 347 | Back alignment and structure |
| >pdb|3ND8|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QG1|A Chain A, Crystal Structure Of P-Loop G239a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3SE0|A Chain A, Structural Characterization Of The Subunit A Mutant F508w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|3SDZ|A Chain A, Structural Characterization Of The Subunit A Mutant F427w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|1VDZ|A Chain A, Crystal Structure Of A-Type Atpase Catalytic Subunit A From Pyrococcus Horikoshii Ot3 Length = 588 | Back alignment and structure |
| >pdb|3ND9|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3M4Y|A Chain A, Structural Characterization Of The Subunit A Mutant P235a Of The A-Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QJY|A Chain A, Crystal Structure Of P-Loop G234a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QIA|A Chain A, Crystal Structure Of P-Loop G237a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3I4L|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A With Amp-Pnp Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3IKJ|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Mutant S238a Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3MFY|A Chain A, Structural Characterization Of The Subunit A Mutant F236a Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|3GQB|A Chain A, Crystal Structure Of The A3b3 Complex From V-atpase Length = 578 | Back alignment and structure |
| >pdb|3A5C|A Chain A, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 578 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 488 | |||
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 0.0 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 0.0 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 5e-54 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 2e-46 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 1e-44 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 4e-36 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 4e-12 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 6e-29 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 2e-28 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 3e-28 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 4e-28 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 5e-27 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 1e-25 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 2e-25 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 2e-22 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-08 |
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 | Back alignment and structure |
|---|
Score = 714 bits (1845), Expect = 0.0
Identities = 272/472 (57%), Positives = 348/472 (73%), Gaps = 13/472 (2%)
Query: 17 VAMEYRTVTGVAGPLVILDKVKGPKYYEIVNIRLGDGTMRRGQVLEVDGEKAVVQVFEGT 76
+ EY+T+T +AGPL+ ++K + Y EIVNI++GDGT+RRGQVL+ + VVQVFEGT
Sbjct: 10 MVKEYKTITQIAGPLIFVEKTEPVGYNEIVNIKMGDGTVRRGQVLDSSADIVVVQVFEGT 69
Query: 77 SGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSE 136
G+D V FTGE LK P S+D+LGRI +GSG+P D GP I+P+ LDI+G+++NP
Sbjct: 70 GGLDKD-CGVIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYA 128
Query: 137 RTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICRQAGLVKRLEKTDNL 196
R P++ IQTGISTID N++ RGQK+P+FSA+GLPHNEIA QI RQA +
Sbjct: 129 RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASV---------- 178
Query: 197 LEDGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERIITPRIA 256
G E FA+VFAAMG+ E AQ+F DFE+ G++ER +FLNLA+DP +ERI+TPR+A
Sbjct: 179 --PGSESAFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMA 236
Query: 257 LTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLAQIYERA 316
LT AEYLAYE G HVLVILTD+++YA+ALR++ AAR EVPGRRGYPGYMYTDLA +YERA
Sbjct: 237 LTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYERA 296
Query: 317 GRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLQNRQIYPPINVLPSL 376
G ++G KGS+TQIPIL+MP DDITHP PDL+GYITEGQI + R+L + IYPPINVLPSL
Sbjct: 297 GIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRKGIYPPINVLPSL 356
Query: 377 SRLMKSAIGEGMTRRDHSDVSNQLYANYAIGKDVQAMKAVVGEEALSSEDLLYLEFLDKF 436
SRLM S IG G TR DH VS+Q+YA YA G+D++ + A+VG+EALS D +LEF D F
Sbjct: 357 SRLMNSGIGAGKTREDHKAVSDQMYAGYAEGRDLRGLVAIVGKEALSERDTKFLEFADLF 416
Query: 437 ERKFVAQGAYDSRNIFQSLDLAWTLLRIFPRELLHRIPGKTLDQYYSRDAAN 488
E KFV QG ++R I +L++ W +L P L RI K + +Y+
Sbjct: 417 EDKFVRQGRNENRTIEDTLEIGWQILTHLPENQLGRIDNKYIQKYHPAHRKA 468
|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Length = 473 | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Length = 498 | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Length = 482 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 488 | |||
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 100.0 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 100.0 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 100.0 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 100.0 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 100.0 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 100.0 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 100.0 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 100.0 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 100.0 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 100.0 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 100.0 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 100.0 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 100.0 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 100.0 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 100.0 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 100.0 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 100.0 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 100.0 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.24 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 96.99 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.74 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 96.63 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.6 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.6 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.54 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.46 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 96.45 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.42 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.27 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 96.26 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.22 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 96.06 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 96.0 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 95.79 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 95.69 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.47 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 95.37 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 95.27 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 95.09 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 95.08 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 95.05 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 94.99 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 94.89 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 94.87 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 94.81 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 94.69 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 94.63 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 94.62 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 94.49 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 94.44 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 94.41 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 94.34 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 94.32 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 94.31 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 94.3 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 94.28 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 94.26 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 94.23 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 94.23 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 94.22 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 94.22 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 94.17 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 94.16 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 94.15 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 94.13 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 94.12 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 94.1 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 94.09 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 94.09 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 94.08 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.07 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 94.03 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 94.03 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.01 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 93.99 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 93.98 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 93.96 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 93.95 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 93.93 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 93.92 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 93.88 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 93.87 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 93.86 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 93.83 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 93.82 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 93.82 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 93.79 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 93.74 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 93.65 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 93.62 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 93.61 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 93.6 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 93.55 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 93.4 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 93.28 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 93.25 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 93.23 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 93.13 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 93.12 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 93.05 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 92.94 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 92.91 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 92.86 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 92.79 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 92.66 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 92.64 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 92.62 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 92.58 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 92.54 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 92.51 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 92.43 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 92.43 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 92.43 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 92.33 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 92.28 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 92.23 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 92.18 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 91.94 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 91.89 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 91.87 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 91.8 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 91.8 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 91.8 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 91.75 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 91.7 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 91.69 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 91.64 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 91.6 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 91.51 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 91.32 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 91.26 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 91.18 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 91.18 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 91.17 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 91.13 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 91.13 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 90.93 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 90.92 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 90.82 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 90.74 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 90.73 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 90.71 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 90.55 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 90.47 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 90.34 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 90.27 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 90.21 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 90.18 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 90.14 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 90.07 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 90.02 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 90.01 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 89.9 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 89.89 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 89.84 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 89.76 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 89.75 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 89.66 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 89.63 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 89.6 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 89.57 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 89.54 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 89.52 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 89.38 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 89.27 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 89.22 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 89.13 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 89.11 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 89.1 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 89.1 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 89.0 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 88.86 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 88.77 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 88.75 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 88.71 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 88.61 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 88.59 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 88.5 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 88.47 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 88.44 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 88.41 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 88.36 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 88.3 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 88.24 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 88.18 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 88.17 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 88.09 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 88.09 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 88.06 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 88.06 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 87.94 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 87.88 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 87.87 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 87.84 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 87.8 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 87.73 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 87.67 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 87.62 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 87.48 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 87.43 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 87.35 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 87.33 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 87.3 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 87.26 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 87.23 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 87.17 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 87.07 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 87.04 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 87.02 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 86.99 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 86.97 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 86.94 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 86.88 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 86.75 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 86.6 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 86.6 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 86.53 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 86.48 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 86.44 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 86.33 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 86.32 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 86.26 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 86.15 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 86.13 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 86.02 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 85.91 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 85.89 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 85.84 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 85.78 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 85.74 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 85.7 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 85.69 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 85.66 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 85.59 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 85.56 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 85.53 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 85.47 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 85.46 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 85.43 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 85.42 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 85.3 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 85.27 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 85.24 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 85.22 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 85.11 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 85.1 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 85.04 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 85.03 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 84.92 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 84.89 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 84.87 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 84.86 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 84.74 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 84.69 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 84.53 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 84.42 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 84.39 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 84.36 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 84.32 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 84.28 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 84.25 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 84.24 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 84.23 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 84.2 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 84.1 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 84.09 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 84.06 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 84.05 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 84.01 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 83.95 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 83.95 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 83.93 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 83.89 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 83.88 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 83.81 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 83.75 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 83.65 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 83.65 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 83.62 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 83.6 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 83.6 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 83.59 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 83.54 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 83.52 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 83.49 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 83.43 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 83.32 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 83.3 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 83.26 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 83.19 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 83.11 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 83.09 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 82.91 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 82.89 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 82.86 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 82.85 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 82.84 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 82.83 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 82.81 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 82.73 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 82.71 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 82.63 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 82.58 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 82.57 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 82.45 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 82.44 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 82.44 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 82.41 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 82.31 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 82.31 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 82.3 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 82.28 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 82.24 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 82.21 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 82.21 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 82.16 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 82.15 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 82.07 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 82.04 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 82.0 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 81.96 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 81.91 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 81.88 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 81.86 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 81.71 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 81.7 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 81.67 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 81.62 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 81.58 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 81.57 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 81.52 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 81.5 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 81.5 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 81.44 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 81.26 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 81.24 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 81.22 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 81.2 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 81.19 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 81.17 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 81.17 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 81.04 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 80.96 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 80.95 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 80.94 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 80.89 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 80.86 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 80.8 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 80.79 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 80.66 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 80.54 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 80.52 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 80.5 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 80.48 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 80.47 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 80.46 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 80.39 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 80.24 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 80.05 |
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
Probab=100.00 E-value=6.5e-123 Score=975.23 Aligned_cols=455 Identities=59% Similarity=1.002 Sum_probs=432.4
Q ss_pred ceeeEEEEEECCEEEEeccCCCCCCcEEEEEeCCCceeEEEEEEEECCeEEEEEccCCCCCccCCCEEEEcCCeeeEecC
Q 011354 19 MEYRTVTGVAGPLVILDKVKGPKYYEIVNIRLGDGTMRRGQVLEVDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVS 98 (488)
Q Consensus 19 ~~~G~V~~I~G~li~v~g~~~~~igE~~~i~~~~g~~~~geVv~~~~~~~~l~~~~~t~Gl~~~G~~V~~tg~~~~VpvG 98 (488)
+++|+|++|.|++++++|++.+.+||+|+|..++|..+.|||++|+++++.+++|++++||+++|++|.+||++++||||
T Consensus 10 ~~~g~v~~v~g~~v~v~gl~~~~~ge~v~i~~~~g~~~~geVv~~~~~~~~~~~~~~~~gl~~~g~~V~~tg~~~~vpvg 89 (465)
T 3vr4_D 10 KEYRTIKEVVGPLMAVEKVSGVKYEELIEVRMQNGEIRRGQVLEVQEDKAMVQIFEGTSGINLKNSSVRFLGHPLQLGVS 89 (465)
T ss_dssp -CBCCEEEEETTEEEEESCCSCCTTCEEEEECTTSCEEEEEEEEEESSEEEEEETTCCTTCCTTTCEEEECSSCCEEEEC
T ss_pred ceEEEEEEEECCEEEEecCCCCCcCCEEEEEcCCCCEEEEEEEEEeCCeEEEEEecCccccccCCCEEEECCCcceeecc
Confidence 58999999999999999998899999999986667778999999999999999999999998559999999999999999
Q ss_pred ccccceEecCCCcccCCCCCCCCCceeeccCCCCCCCCCCCcccceecceeeeeeeeecccCcEEEeccCCCCChhHHHH
Q 011354 99 LDMLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAA 178 (488)
Q Consensus 99 ~~lLGRVlD~lG~PlDg~~~~~~~~~~~i~~~~~~~~~R~~~~~~l~TGI~aID~l~pig~Gqr~gIfg~~G~GKt~Ll~ 178 (488)
++|||||+|++|+|||+++++....++++++.||+|++|.++++||+||||+||+|+|||||||+||||++|+|||+|++
T Consensus 90 ~~lLGRV~d~lG~PiD~~~~i~~~~~~~i~~~~p~p~~R~~~~e~l~TGiraID~l~pigrGQr~~Ifgg~G~GKt~L~~ 169 (465)
T 3vr4_D 90 EDMIGRVFDGLGRPKDNGPEILPEKYLDINGEVINPIARDYPDEFIQTGISAIDHLNTLVRGQKLPVFSGSGLPHKELAA 169 (465)
T ss_dssp GGGTTEEEETTSCBCSCCCCCCCSEEEESSCCCBCTTTEECCCCBCBCSCHHHHTTSCCBTTCBCCEEECTTSCHHHHHH
T ss_pred hhhccceeccCCcccCCCCCCcccceeeccCcccCchhccCcccccccCceEEecccccccCCEEEEeCCCCcChHHHHH
Confidence 99999999999999999999988899999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhcccccccccccccccCCCCCeEEEEEEecCchHHHHHHHHhhccCCCcceEEEEEeCCCCCHHHHHhHHHHHHH
Q 011354 179 QICRQAGLVKRLEKTDNLLEDGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERIITPRIALT 258 (488)
Q Consensus 179 ~i~~~~~~~~~~~~~d~~~~~~~~~~~~~V~~~iGer~e~~~~~~~~l~~~~~~~~tvvv~~t~~~~~~~r~~a~~~a~t 258 (488)
||++++.. + +.+++++|||++||||.+++.++.+++.++|+|+||++|++|+|+||.+|++++|+|+|
T Consensus 170 ~Ia~~~~~-----------~-~d~~~~~~V~~~iGeR~~Ev~e~~~~~~~~g~~~rtvvV~atsd~p~~~r~~a~~~a~t 237 (465)
T 3vr4_D 170 QIARQATV-----------L-DSSDDFAVVFAAIGITFEEAEFFMEDFRQTGAIDRSVMFMNLANDPAIERIATPRMALT 237 (465)
T ss_dssp HHHHHCBC-----------S-SCSSCEEEEEEEEEECHHHHHHHHHHHHHHTGGGGEEEEEEETTSCHHHHHHHHHHHHH
T ss_pred HHHHHHHh-----------c-cCCCceEEEEEEecCCcHHHHHHHHHHhhcCCccceEEEEECCCCCHHHHHHHHHHHHH
Confidence 99998741 1 11356799999999997777777788999999999999999999999999999999999
Q ss_pred HHHHhhHhcCCeEEEEEcchhhHHHHHHHHHHhcCCCCCCCCCCCchhhhHHHHHHhhcccCCCCcceeEEeEEeecCCC
Q 011354 259 TAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLAQIYERAGRIEGRKGSITQIPILTMPNDD 338 (488)
Q Consensus 259 iAEyfr~d~G~~Vlli~Dsltr~a~A~rEisl~~ge~p~~~gyp~~lfs~l~~l~ERag~~~~~~GSIT~i~~v~~~~dD 338 (488)
+|||||+++|+|||++|||+||||+|+||||+++||||+++|||||+|+.|++||||||++++++||||+||+|++|+||
T Consensus 238 iAEyfrd~~G~~VLl~~DslTr~A~A~REisl~lge~P~~~GYp~~vf~~l~~l~ERAg~~~~~~GSIT~i~tv~~~~dD 317 (465)
T 3vr4_D 238 AAEYLAYEKGMHVLVIMTDMTNYAEALREISAARREVPGRRGYPGYLYTNLATLFERAGRIRGLKGSVTQIPILTMPEDD 317 (465)
T ss_dssp HHHHHHHTTCCEEEEEEECHHHHHHHHHHHHHHTTCCCCGGGSCTTHHHHHHHHHTSCEEETTCSCEEEEEEEEECGGGC
T ss_pred HHHHHHHhcCCeEEEEEcChHHHHHHHHHHHhhcCCCCccccCCchHHHHhHHHHHhhhccCCCCCcEEEEEEEEecCCC
Confidence 99999944799999999999999999999999999999999999999999999999999987678999999999999999
Q ss_pred CCCCcccccccccceEEEeeccccccCCCCCCcCCCCcccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHhC
Q 011354 339 ITHPTPDLTGYITEGQIYIDRQLQNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHSDVSNQLYANYAIGKDVQAMKAVVG 418 (488)
Q Consensus 339 ~~dpi~d~~~~i~Dg~ivLsr~La~~g~yPAID~l~S~SR~~~~~~~~~~~~~~h~~~~~~l~~~y~~~~~l~~~~~~~G 418 (488)
++|||||++++|+||||+|||+||++||||||||+.|+||+|+.++++++++++|+++++++++.|+++++|++++++.|
T Consensus 318 ~~~pI~~~~~~i~dg~ivLsr~La~~g~yPAIdvl~S~SR~m~~~ig~~~~~~~h~~~a~~l~~~~~~~~el~~i~~~~G 397 (465)
T 3vr4_D 318 KTHPIPDLTGYITEGQIILTRELYKSGIQPPIDVLPSLSRLKDKGTGAGKTREDHAATMNQLFAAYAQGKQAKELAVVLG 397 (465)
T ss_dssp TTSHHHHHHHHHSSEEEEBCHHHHHTTCSSCBCTTTCEETTGGGSCSTTTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred cccchhHHHhhhcCeEEEEcHHHHhCCCCCCCCccccchhcchhhcCcccCCHHHHHHHHHHHHHHHHHHHHHHHHhhcC
Confidence 99999999999999999999999999999999999999999999998888889999999999999999999999999999
Q ss_pred CcCCCHHHHHHHHHHhHHHHHHhccCCCCCCCHHHHHHHHHHHHHhcchhhhcCCChhhHhhhcccc
Q 011354 419 EEALSSEDLLYLEFLDKFERKFVAQGAYDSRNIFQSLDLAWTLLRIFPRELLHRIPGKTLDQYYSRD 485 (488)
Q Consensus 419 ~d~l~~~~~~~l~~~~~i~~~fL~Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 485 (488)
.|+++++|+..+.+++++++.||+|+++++.+++++++.+|++++.+|.+++.++++++|+|||+++
T Consensus 398 ~d~L~~~d~~~~~~~~~~~~~fL~Q~~~e~~~~~~~~~~l~~~l~~~p~~~~~~~~~~~~~~~~~~~ 464 (465)
T 3vr4_D 398 ESALSDIDKIYAKFAERFENEYVNQGFYTNRTITETLDLGWELLAMLPRTELKRIKDDLLDKYLPEG 464 (465)
T ss_dssp TTSCCHHHHHHHHHHHHHHHHTTCCCTTCCCCHHHHHHHHHHHHTTSCTTTCTTSCHHHHHHHCC--
T ss_pred CCCCCHHHHHHHHhhHHHHHHHhCCCCCCCCCHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHhccCC
Confidence 9999999999999999986699999999999999999999999999999999999999999999985
|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 488 | ||||
| d2jdia3 | 285 | c.37.1.11 (A:95-379) Central domain of alpha subun | 1e-102 | |
| d2jdid3 | 276 | c.37.1.11 (D:82-357) Central domain of beta subuni | 3e-99 | |
| d1fx0a3 | 276 | c.37.1.11 (A:97-372) Central domain of alpha subun | 7e-88 | |
| d1xpua3 | 289 | c.37.1.11 (A:129-417) Transcription termination fa | 8e-45 |
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: Central domain of alpha subunit of F1 ATP synthase species: Cow (Bos taurus) [TaxId: 9913]
Score = 305 bits (784), Expect = e-102
Identities = 75/290 (25%), Positives = 126/290 (43%), Gaps = 11/290 (3%)
Query: 96 PVSLDMLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMN 155
PV ++LGR+ + G ID PI +A + + R E +QTGI +D +
Sbjct: 4 PVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIKAVDSLV 63
Query: 156 SIARGQKIPLFSAAGLPHNEIAAQICRQAGLVKRLEKTDNLLEDGEEDNFAIVFAAMGVN 215
I RGQ+ + IA E+ ++ A+G
Sbjct: 64 PIGRGQRELIIGDRQTGKTSIAIDTIINQKRFND--------GTDEKKKLYCIYVAIGQK 115
Query: 216 METAQFFKRDFEENGSMERVTLFLNLANDPTIERIITPRIALTTAEYLAYECGKHVLVIL 275
T + + +M+ + A+D + + P + EY GKH L+I
Sbjct: 116 RSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDN-GKHALIIY 174
Query: 276 TDMSSYADALREVSAAREEVPGRRGYPGYMYTDLAQIYERAGRIEG--RKGSITQIPILT 333
D+S A A R++S PGR YPG ++ +++ ERA ++ GS+T +P++
Sbjct: 175 DDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIE 234
Query: 334 MPNDDITHPTPDLTGYITEGQIYIDRQLQNRQIYPPINVLPSLSRLMKSA 383
D++ P IT+GQI+++ +L + I P INV S+SR+ +A
Sbjct: 235 TQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAA 284
|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 488 | |||
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 100.0 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 100.0 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 100.0 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 100.0 | |
| d1skye1 | 114 | F1 ATP synthase beta subunit, domain 3 {Bacillus s | 99.22 | |
| d2jdid1 | 118 | F1 ATP synthase beta subunit, domain 3 {Rat (Rattu | 99.19 | |
| d1fx0b1 | 108 | F1 ATP synthase beta subunit, domain 3 {Spinach (S | 99.18 | |
| d1skyb2 | 75 | F1 ATP synthase alpha subunit, domain 1 {Bacillus | 98.47 | |
| d2jdia2 | 71 | F1 ATP synthase alpha subunit, domain 1 {Cow (Bos | 98.39 | |
| d1fx0a2 | 72 | F1 ATP synthase alpha subunit, domain 1 {Spinach ( | 98.23 | |
| d1skye2 | 82 | F1 ATP synthase beta subunit, domain 1 {Bacillus s | 98.21 | |
| d2jdid2 | 72 | F1 ATP synthase beta subunit, domain 1 {Rat (Rattu | 98.17 | |
| d1fx0b2 | 79 | F1 ATP synthase beta subunit, domain 1 {Spinach (S | 98.1 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.28 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.09 | |
| d1fx0a1 | 129 | F1 ATP synthase alpha subunit, domain 3 {Spinach ( | 97.06 | |
| d2jdia1 | 131 | F1 ATP synthase alpha subunit, domain 3 {Cow (Bos | 96.97 | |
| d1skyb1 | 131 | F1 ATP synthase alpha subunit, domain 3 {Bacillus | 96.74 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.66 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 96.66 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 96.61 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.52 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 95.83 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.76 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 95.75 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 95.5 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.44 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 95.44 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 95.35 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.34 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 95.32 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 95.19 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 95.04 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 95.04 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 95.02 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 94.71 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 94.66 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 94.61 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 94.55 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 94.51 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.46 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 94.44 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 94.31 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 94.26 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 94.22 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 94.15 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 94.08 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 94.05 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 93.98 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 93.5 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 93.24 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 93.19 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 93.16 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 92.88 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 92.87 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 92.79 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 92.46 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 92.19 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.02 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 91.92 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 91.76 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 91.7 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 91.69 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 91.68 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 91.59 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 91.16 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 91.13 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 91.08 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 90.82 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 90.45 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 90.45 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 90.2 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 90.2 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 90.2 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 90.13 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 90.1 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 90.02 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 89.96 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 89.74 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 89.72 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 89.58 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 89.46 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 89.41 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 89.32 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 89.21 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 88.95 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 88.87 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 88.79 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 88.73 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 88.33 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 88.25 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 88.25 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 88.18 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 88.17 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 88.1 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 88.03 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 87.95 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 87.87 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 87.83 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 87.44 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 87.37 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 86.87 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 86.74 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 86.48 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 86.48 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 86.46 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 86.41 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 86.37 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 86.32 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 86.17 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 86.11 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 86.01 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 85.89 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 85.68 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 85.66 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 85.59 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 85.57 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 85.53 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 85.52 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 85.46 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 85.45 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 85.41 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 85.34 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 85.33 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 85.33 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 85.3 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 85.3 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 85.13 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 85.07 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 84.93 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 84.78 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 84.77 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 84.75 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 84.72 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 84.68 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 84.68 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 84.66 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 84.47 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 84.47 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 84.3 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 84.12 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 84.02 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 84.0 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 83.92 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 83.91 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 83.73 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 83.7 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 83.67 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 83.56 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 83.41 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 83.28 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 83.2 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 83.14 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 82.9 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 82.89 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 82.77 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 82.76 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 82.69 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 82.66 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 82.62 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 82.52 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 82.35 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 82.33 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 82.16 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 82.11 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 82.08 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 81.96 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 81.8 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 81.75 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 81.69 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 81.32 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 81.16 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 81.15 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 81.02 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 80.96 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 80.73 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 80.6 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 80.12 |
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: Central domain of alpha subunit of F1 ATP synthase species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=1.6e-88 Score=677.26 Aligned_cols=283 Identities=27% Similarity=0.412 Sum_probs=262.7
Q ss_pred eeEecCccccceEecCCCcccCCCCCCCCCceeeccCCCCCCCCCCCcccceecceeeeeeeeecccCcEEEeccCCCCC
Q 011354 93 LKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLP 172 (488)
Q Consensus 93 ~~VpvG~~lLGRVlD~lG~PlDg~~~~~~~~~~~i~~~~~~~~~R~~~~~~l~TGI~aID~l~pig~Gqr~gIfg~~G~G 172 (488)
.+||||++|||||+|++|+|||+++++....++++++.+|+|++|.++++||+||||+||+|+|||||||+||||++|+|
T Consensus 1 i~VPVG~~lLGRVid~~G~piDg~~~~~~~~~~~i~~~~p~~~~R~~i~e~l~TGIraID~l~pig~GQr~~If~~~g~G 80 (285)
T d2jdia3 1 VDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTG 80 (285)
T ss_dssp CEEEESGGGTTCEECTTSCBCSSSCCCCCSEEEESSCCCCCSTTBCCCCSBCCCSCHHHHHHSCCBTTCBCEEEESTTSS
T ss_pred CccccCcCccCcEECCCccccCCCCCCCCCccccccCCCcCchhccCCCcccccCceEEecccCccCCCEEEeecCCCCC
Confidence 47999999999999999999999999988999999999999999999999999999999999999999999999999999
Q ss_pred hhHHHHHHHHHhcccccccccccccccCCCCCeEEEEEEecCchHHHHHHHHhhccCCCcceEEEEEeCCCCCHHHHHhH
Q 011354 173 HNEIAAQICRQAGLVKRLEKTDNLLEDGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERIIT 252 (488)
Q Consensus 173 Kt~Ll~~i~~~~~~~~~~~~~d~~~~~~~~~~~~~V~~~iGer~e~~~~~~~~l~~~~~~~~tvvv~~t~~~~~~~r~~a 252 (488)
||+|+.+++++....+. +. ......+|||++||||.+++.++++.+.++++++||++|++|+++||.+|+++
T Consensus 81 Kt~ll~~~~~~~~~~~~--~~------~~~~~~~~v~~~IGer~~E~~e~~~~~~~~~~~~~tvvv~~ts~~~~~~r~~~ 152 (285)
T d2jdia3 81 KTSIAIDTIINQKRFND--GT------DEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLA 152 (285)
T ss_dssp HHHHHHHHHHHTHHHHT--SS------CTTTCCEEEEEEESCCHHHHHHHHHHHHHTTCGGGEEEEEECTTSCHHHHHHH
T ss_pred hHHHHHHHHHhHHhhcc--cc------ccccceEEEEeeeCccHHHHHHHHHHhcccccccceEEEEECCCCCHHHHHHH
Confidence 99999888776532110 01 12345589999999997777777888888888999999999999999999999
Q ss_pred HHHHHHHHHHhhHhcCCeEEEEEcchhhHHHHHHHHHHhcCCCCCCCCCCCchhhhHHHHHHhhcccCC--CCcceeEEe
Q 011354 253 PRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLAQIYERAGRIEG--RKGSITQIP 330 (488)
Q Consensus 253 ~~~a~tiAEyfr~d~G~~Vlli~Dsltr~a~A~rEisl~~ge~p~~~gyp~~lfs~l~~l~ERag~~~~--~~GSIT~i~ 330 (488)
+++|||+||||| |+||||||++||+||||+|+||||+++||+|+++||||++|+.|++||||||++++ ++||||+|+
T Consensus 153 ~~~a~tiAEyfr-d~G~~VLll~Dsltr~A~A~rEis~~~ge~p~~~gyp~~~~~~~~~l~ERag~~~~~~~~GSiT~i~ 231 (285)
T d2jdia3 153 PYSGCSMGEYFR-DNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALP 231 (285)
T ss_dssp HHHHHHHHHHHH-HTTCEEEEEEETHHHHHHHHHHHHHHTTCCCCGGGCCTTHHHHHHHHHTTCCBBCGGGTCCEEEEEE
T ss_pred HHHHHHHHHHHH-HcCCcEEEEEcChHHHHHHHHHHHHhcCCCCCcCCcCchHHHHHHHHHHHHhcccCCCCCeeEEEEE
Confidence 999999999999 89999999999999999999999999999999999999999999999999999754 379999999
Q ss_pred EEeecCCCCCCCcccccccccceEEEeeccccccCCCCCCcCCCCccccccccc
Q 011354 331 ILTMPNDDITHPTPDLTGYITEGQIYIDRQLQNRQIYPPINVLPSLSRLMKSAI 384 (488)
Q Consensus 331 ~v~~~~dD~~dpi~d~~~~i~Dg~ivLsr~La~~g~yPAID~l~S~SR~~~~~~ 384 (488)
+|++|+||++|||+|++++|+||||+|||+||++||||||||+.|+||+|+++|
T Consensus 232 ~v~~~~dD~tdpI~~~~~~i~dg~ivLsr~la~~g~yPAID~l~S~SR~~~~~q 285 (285)
T d2jdia3 232 VIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQ 285 (285)
T ss_dssp EEECSTTCTTSHHHHHHHHHSSEEEEBCHHHHHHTCSSCBCTTTCEESSGGGGS
T ss_pred EEEecCCCCCCchhHHHHhhcCcEEEEcHHHHhcCCCCCcCCcccccccCcccC
Confidence 999999999999999999999999999999999999999999999999999754
|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1skye1 a.69.1.1 (E:357-470) F1 ATP synthase beta subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2jdid1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fx0b1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fx0a1 a.69.1.1 (A:373-501) F1 ATP synthase alpha subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2jdia1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1skyb1 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|