Citrus Sinensis ID: 011408


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480------
MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSNDVDQSSHMLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQLHNGTFMQQDAEECWTQLLYTLSQSLRSVNASEIPDTVKALFGIDIVSRVHCQESGEESSETESIYALKCHISHEVNHLHEGLKHGLKSELEKASPALGRSAVYLKESCINGLPRYLTIQFVRFFWKRESNQKAKILRKVDYPLELDVYDFCSDDLRKKLDAPRQKLRDEEGKKLGLKGGEKSSNSKDNDVKMTEAEGSASNGSGESSVASSQDGVTTDTDKETHLTGIYDLVAVLTHKGRSADSGHYVAWVKQESGKWIEYDDDNPLPQREEDITKLSGGGDWHMAYICMYKARSISM
cEEEEEEEccEEEccEEccccccHHHHHHHHHHHccccccccEEEEccccccccccccccccccccEEEEEcccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHcccEEEEEEEEEEcccccCCccccccEEEEEEEEccccHHHHHHHHcccHHHcccccccccccEEEEcEEEcccccEEEEEEEEEEEEcccccccEEEccCCccccccccccccHHHHHHccccHHHHHHHcccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccEEEEEEEEEccccccccEEEEEEEcccccEEEccccccccccHHHHHHHccccccccEEEEEEEEccccc
MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKY**************MLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQLHNGTFMQQDAEECWTQLLYTLSQSLRSVNASEIPDTVKALFGIDIVSRVHCQESGEESSETESIYALKCHISHEVNHLHEGLKHGLKSELEKASPALGRSAVYLKESCINGLPRYLTIQFVRFFWKRESNQKAKILRKVDYPLELDVYDFCSDDLRKKLDAPRQKLRDEEGK************************************************KETHLTGIYDLVAVLTHKGRSADSGHYVAWVKQESGKWIEYDDDNPLPQREEDITKLSGGGDWHMAYICMYKARSIS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSNDVDQSSHMLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQLHNGTFMQQDAEECWTQLLYTLSQSLRSVNASEIPDTVKALFGIDIVSRVHCQESGEESSETESIYALKCHISHEVNHLHEGLKHGLKSELEKASPALGRSAVYLKESCINGLPRYLTIQFVRFFWKRESNQKAKILRKVDYPLELDVYDFCSDDLRKKLDAPRQKLRDEEGKKLGLKGGEKSSNSKDNDVKMTEAEGSASNGSGESSVASSQDGVTTDTDKETHLTGIYDLVAVLTHKGRSADSGHYVAWVKQESGKWIEYDDDNPLPQREEDITKLSGGGDWHMAYICMYKARSISM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 6 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.confidentQ949Y0
Ubiquitin carboxyl-terminal hydrolase 7 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.probableQ84WC6
Ubiquitin carboxyl-terminal hydrolase 6 Ubiquitin-protein hydrolase is involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin.probableQ92353

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AYN, chain A
Confidence level:very confident
Coverage over the Query: 100-359,397-482
View the alignment between query and template
View the model in PyMOL
Template: 1WGG, chain A
Confidence level:very confident
Coverage over the Query: 1-84
View the alignment between query and template
View the model in PyMOL