Query         011449
Match_columns 485
No_of_seqs    30 out of 32
Neff          1.9 
Searched_HMMs 46136
Date          Fri Mar 29 01:29:12 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/011449.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/011449hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist  94.5  0.0018 3.8E-08   54.6  -4.5  100  271-381    17-128 (129)
  2 cd08780 Death_TRADD Death Doma  91.2    0.14   3E-06   44.3   2.1   14   51-64     47-60  (90)
  3 cd08313 Death_TNFR1 Death doma  87.4    0.39 8.6E-06   39.8   2.1   17   50-66     37-53  (80)
  4 cd08319 Death_RAIDD Death doma  85.2    0.62 1.4E-05   38.7   2.1   17   51-67     41-57  (83)
  5 cd08777 Death_RIP1 Death Domai  78.2     1.6 3.6E-05   36.1   2.2   15   51-65     42-56  (86)
  6 cd08316 Death_FAS_TNFRSF6 Deat  75.9     1.9 4.1E-05   36.8   2.1   15   51-65     48-62  (97)
  7 cd08784 Death_DRs Death Domain  73.8     3.4 7.5E-05   33.3   2.9   30   33-65     23-52  (79)
  8 cd08779 Death_PIDD Death Domai  73.3     2.6 5.6E-05   34.7   2.1   16   51-66     41-56  (86)
  9 cd08318 Death_NMPP84 Death dom  69.3     5.4 0.00012   32.7   3.1   29   34-67     33-61  (86)
 10 cd08804 Death_ank2 Death domai  65.8     4.8  0.0001   33.1   2.2   15   51-65     43-57  (84)
 11 cd08306 Death_FADD Fas-associa  65.1     4.9 0.00011   33.0   2.1   15   51-65     41-55  (86)
 12 cd08315 Death_TRAILR_DR4_DR5 D  64.6     4.6  0.0001   34.1   2.0   15   52-66     47-61  (96)
 13 cd08317 Death_ank Death domain  49.6      14  0.0003   29.8   2.3   14   52-65     44-57  (84)
 14 smart00005 DEATH DEATH domain,  43.1      20 0.00043   27.9   2.2   15   51-65     45-59  (88)
 15 cd08805 Death_ank1 Death domai  40.1      23  0.0005   29.7   2.3   15   51-65     43-57  (84)
 16 cd08815 Death_TNFRSF25_DR3 Dea  39.6      18  0.0004   30.6   1.6   20   47-66     34-53  (77)
 17 cd01670 Death Death Domain: a   39.1      39 0.00086   25.6   3.2   17   51-67     37-53  (79)
 18 cd08311 Death_p75NR Death doma  31.9      32 0.00068   28.3   1.8   13   53-65     40-52  (77)
 19 cd08803 Death_ank3 Death domai  31.7      38 0.00082   28.2   2.2   29   34-66     30-58  (84)
 20 PF11464 Rbsn:  Rabenosyn Rab b  31.3      60  0.0013   25.0   3.0   28   34-61     10-37  (42)
 21 TIGR02132 phaR_Bmeg polyhydrox  29.8      72  0.0016   31.2   4.0   41   21-61     83-136 (189)
 22 PF02840 Prp18:  Prp18 domain;   29.3      53  0.0011   30.4   3.0   40   55-95      5-51  (144)
 23 KOG3598 Thyroid hormone recept  28.4      78  0.0017   39.1   4.7  156  262-461  1694-1853(2220)
 24 PF12588 PSDC:  Phophatidylseri  28.2      80  0.0017   29.0   3.9   40   51-90     98-138 (141)
 25 COG0113 HemB Delta-aminolevuli  28.0      25 0.00053   36.6   0.7   13  354-367   218-230 (330)
 26 PF00531 Death:  Death domain;   27.4      52  0.0011   24.9   2.2   15   51-65     39-53  (83)
 27 PF14193 DUF4315:  Domain of un  22.5 1.8E+02  0.0039   24.8   4.7   31   19-49     10-40  (83)
 28 PHA01513 mnt Mnt                22.1 1.6E+02  0.0035   25.3   4.3   41   37-93     22-62  (82)
 29 KOG2345 Serine/threonine prote  22.0      47   0.001   34.2   1.4   37  294-330   201-249 (302)
 30 PF06931 Adeno_E4_ORF3:  Mastad  22.0      65  0.0014   29.3   2.1   15   51-65     21-35  (113)
 31 smart00150 SPEC Spectrin repea  21.9 2.8E+02   0.006   20.6   5.2   46   15-64     40-88  (101)
 32 PLN03166 60S ribosomal protein  21.7      48   0.001   29.0   1.2   16  215-232    41-56  (96)
 33 COG0373 HemA Glutamyl-tRNA red  21.5      86  0.0019   33.2   3.1   45   25-69    293-337 (414)
 34 PF00435 Spectrin:  Spectrin re  20.5 3.6E+02  0.0077   20.0   5.5   49   15-64     43-91  (105)
 35 PRK04059 rpl34e 50S ribosomal   20.3      53  0.0012   28.4   1.1   16  215-232    34-49  (88)
 36 PF05596 Taeniidae_ag:  Taeniid  20.2      34 0.00074   28.0  -0.0   20  347-366     8-27  (64)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=94.53  E-value=0.0018  Score=54.56  Aligned_cols=100  Identities=25%  Similarity=0.608  Sum_probs=54.2

Q ss_pred             HHHHhhhcCCccC----CcccccccccCCCCCcccccccccccchhhhhhhcccccchhhcccCccccCCCCCCCCchhh
Q 011449          271 AALSARAQGKDVG----IPECEGAATAKSPWNAPELFDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHE  346 (485)
Q Consensus       271 aAL~Ak~qgk~VG----iP~CeGaat~KsPWNApelFdl~~legetirewlFFDkPRRAfeSGnRkQRslpDY~gRGWhE  346 (485)
                      .-|..|+.|...-    |++|  -.-+..||.-|..++.    ++  ++|+||=+.++....|+|+.|.-.   |=-||.
T Consensus        17 ~yL~~k~~g~~~~~~~~i~~~--Diy~~~P~~L~~~~~~----~~--~~~yFF~~~~~~~~~~~r~~R~~~---~G~Wk~   85 (129)
T PF02365_consen   17 HYLRPKILGEPLPCEDVIHDV--DIYSAHPWELPAKFKG----GD--EEWYFFSPRKKKYPNGGRPNRVTG---GGYWKS   85 (129)
T ss_dssp             CTHHHHHTT-HHCS-CHSEE----GGGS-GGGCHHHSSS-----S--SEEEEEEE----------S-EEET---TEEEEE
T ss_pred             HHHHHHhcCCCCCcccceeec--ccCccChHHhhhhccC----CC--ceEEEEEecccccCCccccccccc---ceEEee
Confidence            4577777776521    4445  5667799988853322    22  399999999999999999999755   444997


Q ss_pred             hHH--HHHH---HhcCcccc--cccCCCC-CCCcceeeeEEee
Q 011449          347 SRK--QVMN---EFGGLKRS--YYMDPQP-LNHFEWHLYEYEI  381 (485)
Q Consensus       347 SRK--qvMk---e~gGlkrS--YYMDPQP-~~~~eWHlyEYei  381 (485)
                      +.+  .|+.   ..-|.||+  ||.-.++ ...-.|-|.||.|
T Consensus        86 ~g~~~~i~~~~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L  128 (129)
T PF02365_consen   86 TGKEKPIKDPGGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSL  128 (129)
T ss_dssp             ECEEEEEEE-TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE
T ss_pred             cccccccccccceeeeeEEEEEEEeccCCCCCcCCeEEEEEEe
Confidence            765  3433   24456664  6643333 3466899999987


No 2  
>cd08780 Death_TRADD Death Domain of Tumor Necrosis Factor Receptor 1-Associated Death Domain protein. Death domain (DD) of TRADD (TNF Receptor 1-Associated Death Domain or TNFRSF1A-associated via death domain) protein. TRADD is a central signaling adaptor for TNF-receptor 1 (TNFR1), mediating activation of Nuclear Factor -kappaB (NF-kB) and c-Jun N-terminal kinase (JNK), as well as caspase-dependent apoptosis. It also carries important immunological roles including germinal center formation, DR3-mediated T-cell stimulation, and TNFalpha-mediated inflammatory responses. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into s
Probab=91.24  E-value=0.14  Score=44.26  Aligned_cols=14  Identities=43%  Similarity=0.510  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHh
Q 011449           51 LEEQVHQMLREWKA   64 (485)
Q Consensus        51 LEeQvhQmLREWkA   64 (485)
                      |+|||+||||+|+.
T Consensus        47 L~EqvyQ~L~~W~~   60 (90)
T cd08780          47 LYEQAYQLLRRFIQ   60 (90)
T ss_pred             HHHHHHHHHHHHHH
Confidence            89999999999996


No 3  
>cd08313 Death_TNFR1 Death domain of Tumor Necrosis Factor Receptor 1. Death Domain (DD) found in tumor necrosis factor receptor-1 (TNFR-1). TNFR-1 has many names including TNFRSF1A, CD120a, p55, p60, and TNFR60. It activates two major intracellular signaling pathways that lead to the activation of the transcription factor NF-kB and the induction of cell death. Upon binding of its ligand TNF, TNFR-1 trimerizes which leads to the recruitment of an adaptor protein named TNFR-associated death domain protein (TRADD) through a DD/DD interaction. Mutations in the TNFRSF1A gene causes TNFR-associated periodic syndrome (TRAPS), a rare disorder characterized recurrent fever, myalgia, abdominal pain, conjunctivitis and skin eruptions. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation a
Probab=87.42  E-value=0.39  Score=39.77  Aligned_cols=17  Identities=29%  Similarity=0.407  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHhhc
Q 011449           50 LLEEQVHQMLREWKAEL   66 (485)
Q Consensus        50 vLEeQvhQmLREWkAEL   66 (485)
                      -+.||++||||.|+.--
T Consensus        37 ~~~Eq~yqmL~~W~~~~   53 (80)
T cd08313          37 RCRDAQYQMLKVWKERG   53 (80)
T ss_pred             ChHHHHHHHHHHHHHhc
Confidence            57899999999999643


No 4  
>cd08319 Death_RAIDD Death domain of RIP-associated ICH-1 homologous protein with a death domain. Death domain (DD) of RAIDD (RIP-associated ICH-1 homologous protein with a death domain), also known as CRADD (Caspase and RIP adaptor). RAIDD is an adaptor protein that together with the p53-inducible protein PIDD and caspase-2, forms the PIDDosome complex, which is required for caspase-2 activation and plays a role in mediating stress-induced apoptosis. RAIDD contains an N-terminal Caspase Activation and Recruitment Domain (CARD), which interacts with the caspase-2 CARD, and a C-terminal DD, which interacts with the DD of PIDD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD, DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other pr
Probab=85.18  E-value=0.62  Score=38.70  Aligned_cols=17  Identities=18%  Similarity=0.577  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHhhcC
Q 011449           51 LEEQVHQMLREWKAELH   67 (485)
Q Consensus        51 LEeQvhQmLREWkAEL~   67 (485)
                      ++|||+|||+.||..-.
T Consensus        41 l~eQv~~mL~~W~~r~G   57 (83)
T cd08319          41 VQSQIVEALVKWRQRFG   57 (83)
T ss_pred             HHHHHHHHHHHHHHhcC
Confidence            79999999999998644


No 5  
>cd08777 Death_RIP1 Death Domain of Receptor-Interacting Protein 1. Death domain (DD) found in Receptor-Interacting Protein 1 (RIP1) and related proteins. RIP kinases serve as essential sensors of cellular stress. Vertebrates contain several types containing a homologous N-terminal kinase domain and varying C-terminal domains. RIP1 harbors a C-terminal DD, which binds death receptors (DRs) including TNF receptor 1, Fas, TNF-related apoptosis-inducing ligand receptor 1 (TRAILR1), and TRAILR2. It also interacts with other DD-containing adaptor proteins such as TRADD and FADD. RIP1 plays a crucial role in determining a cell's fate, between survival or death, following exposure to stress signals. It is important in the signaling of NF-kappaB and MAPKs, and it links DR-associated signaling to reactive oxygen species (ROS) production. Abnormal RIP1 function may result in ROS accumulation affecting inflammatory responses, innate immunity, stress responses, and cell survival. In general, DDs ar
Probab=78.20  E-value=1.6  Score=36.08  Aligned_cols=15  Identities=60%  Similarity=1.119  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHhh
Q 011449           51 LEEQVHQMLREWKAE   65 (485)
Q Consensus        51 LEeQvhQmLREWkAE   65 (485)
                      ++||++|||+.|+..
T Consensus        42 ~~eq~~~mL~~W~~r   56 (86)
T cd08777          42 LKEKVHQMLHKWKMK   56 (86)
T ss_pred             HHHHHHHHHHHHHHc
Confidence            689999999999974


No 6  
>cd08316 Death_FAS_TNFRSF6 Death domain of FAS or TNF receptor superfamily member 6. Death Domain (DD) found in the FS7-associated cell surface antigen (FAS). FAS, also known as TNFRSF6 (TNF receptor superfamily member 6), APT1, CD95, FAS1, or APO-1, together with FADD (Fas-associating via Death Domain) and caspase 8, is an integral part of the death inducing signalling complex (DISC), which plays an important role in the induction of apoptosis and is activated by binding of the ligand FasL to FAS. FAS also plays a critical role in self-tolerance by eliminating cell types (autoreactive T and B cells) that contribute to autoimmunity. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in sign
Probab=75.94  E-value=1.9  Score=36.84  Aligned_cols=15  Identities=40%  Similarity=0.614  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHhh
Q 011449           51 LEEQVHQMLREWKAE   65 (485)
Q Consensus        51 LEeQvhQmLREWkAE   65 (485)
                      +.||++||||.|+.-
T Consensus        48 ~~Eq~~qmL~~W~~~   62 (97)
T cd08316          48 TAEQKVQLLRAWYQS   62 (97)
T ss_pred             hHHHHHHHHHHHHHH
Confidence            489999999999964


No 7  
>cd08784 Death_DRs Death Domain of Death Receptors. Death domain (DD) found in death receptor proteins. Death receptors are members of the tumor necrosis factor (TNF) receptor superfamily, characterized by having a cytoplasmic DD. Known members of the family are Fas (CD95/APO-1), TNF-receptor 1 (TNFR1/TNFRSF1A/p55/CD120a), TNF-related apoptosis-inducing ligand receptor 1 (TRAIL-R1 /DR4), and receptor 2 (TRAIL-R2/DR5/APO-2/KILLER), as well as Death Receptor 3 (DR3/APO-3/TRAMP/WSL-1/LARD). They are involved in apoptosis signaling pathways. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=73.76  E-value=3.4  Score=33.33  Aligned_cols=30  Identities=20%  Similarity=0.385  Sum_probs=21.2

Q ss_pred             hhhhHHHhhhccccchHHHHHHHHHHHHHHHhh
Q 011449           33 FLDLQFARKESRTVDVSLLEEQVHQMLREWKAE   65 (485)
Q Consensus        33 F~~LQ~ARKEsRs~D~avLEeQvhQmLREWkAE   65 (485)
                      |++-+--+-|..+.|   +.||++|||+.|+.-
T Consensus        23 ls~~~I~~ie~~~~~---~~eq~~~mL~~W~~k   52 (79)
T cd08784          23 LSDNEIKVAELDNPQ---HRDRVYELLRIWRNK   52 (79)
T ss_pred             CCHHHHHHHHHcCCc---hHHHHHHHHHHHHhc
Confidence            344444445566666   689999999999964


No 8  
>cd08779 Death_PIDD Death Domain of p53-induced protein with a death domain. Death domain (DD) found in PIDD (p53-induced protein with a death domain) and similar proteins. PIDD is a component of the PIDDosome complex, which is an oligomeric caspase-activating complex involved in caspase-2 activation and plays a role in mediating stress-induced apoptosis. The PIDDosome complex is composed of three components, PIDD, RAIDD and caspase-2, which interact through their DDs and DD-like domains. The DD of PIDD interacts with the DD of RAIDD, which also contains a Caspase Activation and Recruitment Domain (CARD) that interacts with the caspase-2 CARD. Autoproteolysis of PIDD determines the downstream signaling event, between pro-survival NF-kB or pro-death caspase-2 activation. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members 
Probab=73.31  E-value=2.6  Score=34.70  Aligned_cols=16  Identities=38%  Similarity=0.721  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHhhc
Q 011449           51 LEEQVHQMLREWKAEL   66 (485)
Q Consensus        51 LEeQvhQmLREWkAEL   66 (485)
                      |.+|+++||+.|+..-
T Consensus        41 l~eq~~~mL~~W~~~~   56 (86)
T cd08779          41 LDEQIFDMLFSWAQRQ   56 (86)
T ss_pred             HHHHHHHHHHHHHHhc
Confidence            6899999999998754


No 9  
>cd08318 Death_NMPP84 Death domain of Nuclear Matrix Protein P84. Death domain (DD) found in the Nuclear Matrix Protein P84 (also known as HPR1 or THOC1). HPR1/p84 resides in the nuclear matrix and is part of the THO complex, also called TREX (transcription/export) complex, which functions in mRNP biogenesis at the interface between transcription and export of mRNA from the nucleus. Mice lacking THOC1 have abnormal testis development and are sterile. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=69.31  E-value=5.4  Score=32.70  Aligned_cols=29  Identities=21%  Similarity=0.424  Sum_probs=20.4

Q ss_pred             hhhHHHhhhccccchHHHHHHHHHHHHHHHhhcC
Q 011449           34 LDLQFARKESRTVDVSLLEEQVHQMLREWKAELH   67 (485)
Q Consensus        34 ~~LQ~ARKEsRs~D~avLEeQvhQmLREWkAEL~   67 (485)
                      .+++..+.+.+  |   +.+|++|||+.|+..-.
T Consensus        33 ~dI~~i~~~~~--~---~~eq~~~mL~~W~~r~g   61 (86)
T cd08318          33 KEIRAIESDSE--D---IKMQAKQLLVAWQDREG   61 (86)
T ss_pred             HHHHHHHhcCC--C---HHHHHHHHHHHHHHhcC
Confidence            34555555543  5   58999999999997543


No 10 
>cd08804 Death_ank2 Death domain of Ankyrin-2. Death Domain (DD) of Ankyrin-2 (ANK-2) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-2, also called ankyrin-B (for broadly expressed), is required for proper function of the Na/Ca ion exchanger-1 in cardiomyocytes, and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. Human ANK-2 is associated with "Ankyrin-B syndrome", an atypical arrythmia disorder with risk of sudden cardiac death. It also plays key roles in the brain and striated muscle. Loss of ANK-2 is associated with significant nervous system defects and sarcomere disorganization. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other
Probab=65.82  E-value=4.8  Score=33.10  Aligned_cols=15  Identities=33%  Similarity=0.782  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHhh
Q 011449           51 LEEQVHQMLREWKAE   65 (485)
Q Consensus        51 LEeQvhQmLREWkAE   65 (485)
                      +.+|+++||+.|+..
T Consensus        43 ~~eq~~~mL~~W~~r   57 (84)
T cd08804          43 LQDQSHALLKYWLER   57 (84)
T ss_pred             HHHHHHHHHHHHHHc
Confidence            589999999999975


No 11 
>cd08306 Death_FADD Fas-associated Death Domain protein-protein interaction domain. Death domain (DD) found in FAS-associated via death domain (FADD). FADD is a component of the death-inducing signaling complex (DISC) and serves as an adaptor in the signaling pathway of death receptor proteins. It modulates apoptosis as well as non-apoptotic processes such as cell cycle progression, survival, innate immune signaling, and hematopoiesis. FADD contains an N-terminal DED and a C-terminal DD. Its DD interacts with the DD of the activated death receptor, FAS, and its DED recruits the initiator caspases, caspase-8 and -10, to the DISC complex via a homotypic interaction with the N-terminal DED of the caspase. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain),
Probab=65.15  E-value=4.9  Score=33.01  Aligned_cols=15  Identities=67%  Similarity=0.946  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHhh
Q 011449           51 LEEQVHQMLREWKAE   65 (485)
Q Consensus        51 LEeQvhQmLREWkAE   65 (485)
                      +.||++|||+.|+..
T Consensus        41 ~~eq~~~mL~~W~~~   55 (86)
T cd08306          41 LREQVRQSLREWKKI   55 (86)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            579999999999974


No 12 
>cd08315 Death_TRAILR_DR4_DR5 Death domain of Tumor necrosis factor-Related Apoptosis-Inducing Ligand Receptors. Death Domain (DD) found in Tumor necrosis factor-Related Apoptosis-Inducing Ligand (TRAIL) Receptors. In mammals, this family includes TRAILR1 (also called DR4 or TNFRSF10A) and TRAILR2 (also called DR5, TNFRSF10B, or KILLER). They function as receptors for the cytokine TRAIL and are involved in apoptosis signaling pathways. TRAIL preferentially induces apoptosis in cancer cells while exhibiting little toxicity in normal cells. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=64.62  E-value=4.6  Score=34.06  Aligned_cols=15  Identities=40%  Similarity=0.603  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHhhc
Q 011449           52 EEQVHQMLREWKAEL   66 (485)
Q Consensus        52 EeQvhQmLREWkAEL   66 (485)
                      .||++|||+.|+.--
T Consensus        47 ~eq~~qmL~~W~~~~   61 (96)
T cd08315          47 REQLYQMLLTWVNKT   61 (96)
T ss_pred             HHHHHHHHHHHHHhh
Confidence            799999999999653


No 13 
>cd08317 Death_ank Death domain associated with Ankyrins. Death Domain (DD) associated with Ankyrins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. Ankyrins function as adaptor proteins and they interact, through ANK repeats, with structurally diverse membrane proteins, including ion channels/pumps, calcium release channels, and cell adhesion molecules. They play critical roles in the proper expression and membrane localization of these proteins. In mammals, this family includes ankyrin-R for restricted (or ANK1), ankyrin-B for broadly expressed (or ANK2) and ankyrin-G for general or giant (or ANK3). They are expressed in different combinations in many tissues and play non-overlapping functions. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-associati
Probab=49.64  E-value=14  Score=29.79  Aligned_cols=14  Identities=29%  Similarity=0.624  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHhh
Q 011449           52 EEQVHQMLREWKAE   65 (485)
Q Consensus        52 EeQvhQmLREWkAE   65 (485)
                      .||++|||+.|+..
T Consensus        44 ~eq~~~mL~~W~~r   57 (84)
T cd08317          44 AQQAQAMLKLWLER   57 (84)
T ss_pred             HHHHHHHHHHHHHh
Confidence            49999999999986


No 14 
>smart00005 DEATH DEATH domain, found in proteins involved in cell death (apoptosis). Alpha-helical domain present in a variety of proteins with apoptotic functions. Some (but not all) of these domains form homotypic and heterotypic dimers.
Probab=43.06  E-value=20  Score=27.90  Aligned_cols=15  Identities=47%  Similarity=0.762  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHhh
Q 011449           51 LEEQVHQMLREWKAE   65 (485)
Q Consensus        51 LEeQvhQmLREWkAE   65 (485)
                      +.+|+.|||++|+..
T Consensus        45 ~~~~~~~lL~~W~~~   59 (88)
T smart00005       45 LAEQSVQLLRLWEQR   59 (88)
T ss_pred             HHHHHHHHHHHHHHc
Confidence            478999999999875


No 15 
>cd08805 Death_ank1 Death domain of Ankyrin-1. Death Domain (DD) of the human protein ankyrin-1 (ANK-1) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-1, also called ankyrin-R (for restricted), is found in brain, muscle, and erythrocytes and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. It plays a critical nonredundant role in erythroid development and is associated with hereditary spherocytosis (HS), a common disorder of the red cell membrane. The small alternatively-spliced variant, sANK-1, found in striated muscle and concentrated in the sarcoplasmic reticulum (SR) binds obscurin and titin, which facilitates the anchoring of the network SR to the contractile apparatus. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common featur
Probab=40.08  E-value=23  Score=29.66  Aligned_cols=15  Identities=33%  Similarity=0.510  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHhh
Q 011449           51 LEEQVHQMLREWKAE   65 (485)
Q Consensus        51 LEeQvhQmLREWkAE   65 (485)
                      +.+|+++||+.|+..
T Consensus        43 l~~Q~~~~L~~W~~r   57 (84)
T cd08805          43 LLEQSTALLNLWVDR   57 (84)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            679999999999975


No 16 
>cd08815 Death_TNFRSF25_DR3 Death domain of Tumor Necrosis Factor Receptor superfamily 25. Death Domain (DD) found in Tumor Necrosis Factor (TNF) receptor superfamily 25 (TNFRSF25), also known as TRAMP (TNF receptor-related apoptosis-mediating protein), LARD, APO-3, WSL-1, or DR3 (Death Receptor-3). TNFRSF25 is primarily expressed in T cells, is activated by binding to its ligand TL1A, and plays an important role in T-cell function. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=39.56  E-value=18  Score=30.62  Aligned_cols=20  Identities=20%  Similarity=0.634  Sum_probs=16.2

Q ss_pred             chHHHHHHHHHHHHHHHhhc
Q 011449           47 DVSLLEEQVHQMLREWKAEL   66 (485)
Q Consensus        47 D~avLEeQvhQmLREWkAEL   66 (485)
                      |..-.+||+||||+-|+..-
T Consensus        34 ~~~~~rda~y~ML~~W~~q~   53 (77)
T cd08815          34 EIGRFRDQQYEMLKRWRQQQ   53 (77)
T ss_pred             cccchHHHHHHHHHHHHHcC
Confidence            33567899999999999764


No 17 
>cd01670 Death Death Domain: a protein-protein interaction domain. Death Domains (DDs) are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. Structural analysis of DD-DD complexes show that the domains interact with each other in many different ways. DD-containing proteins serve as adaptors in signaling pathways and they can recruit other proteins into signaling complexes. In mammals, they are prominent components of the programmed cell death (apoptosis) pathway and are found in a number of other signaling pathways. In invertebrates, they are involved in transcriptional regulation of zygotic patterning genes in insect embryogenesis, and are components of the ToII/NF-kappaB pathway, a conserved innate immune pathway in a
Probab=39.10  E-value=39  Score=25.64  Aligned_cols=17  Identities=29%  Similarity=0.520  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHhhcC
Q 011449           51 LEEQVHQMLREWKAELH   67 (485)
Q Consensus        51 LEeQvhQmLREWkAEL~   67 (485)
                      +.+|.++||+.|+..-.
T Consensus        37 ~~~~~~~mL~~W~~~~~   53 (79)
T cd01670          37 VREQAYQLLLKWEEREG   53 (79)
T ss_pred             HHHHHHHHHHHHHhccC
Confidence            68999999999987643


No 18 
>cd08311 Death_p75NR Death domain of p75 Neurotophin Receptor. Death Domain (DD) found in p75 neurotrophin receptor (p75NTR, NGFR, TNFRSF16). p75NTR binds members of the neurotrophin (NT) family including nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), and NT3, among others. It contains an NT-binding extracellular region that bears four cysteine-rich repeats, a transmembrane domain, and an intracellular DD. p75NTR plays roles in the immune, vascular, and nervous systems, and has been shown to promote cell death or survival, and to induce neurite outgrowth or collapse depending on its ligands and co-receptors. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptor
Probab=31.85  E-value=32  Score=28.34  Aligned_cols=13  Identities=31%  Similarity=0.803  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHhh
Q 011449           53 EQVHQMLREWKAE   65 (485)
Q Consensus        53 eQvhQmLREWkAE   65 (485)
                      +|+++||++|+..
T Consensus        40 ~p~~~lL~~W~~r   52 (77)
T cd08311          40 SPVRTLLADWSAQ   52 (77)
T ss_pred             hHHHHHHHHHHHC
Confidence            8999999999973


No 19 
>cd08803 Death_ank3 Death domain of Ankyrin-3. Death Domain (DD) of the human protein ankyrin-3 (ANK-3) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-3, also called anykyrin-G (for general or giant), is found in neurons and at least one splice variant has been shown to be essential for propagation of action potentials as a binding partner to neurofascin and voltage-gated sodium channels. It is required for maintaining axo-dendritic polarity, and may be a genetic risk factor associated with bipolar disorder. ANK-3 may also play roles in other cell types. Mutations affecting ANK-3 pathways for Na channel localization are associated with Brugada syndrome, a potentially fata arrythmia. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by se
Probab=31.67  E-value=38  Score=28.23  Aligned_cols=29  Identities=21%  Similarity=0.298  Sum_probs=19.8

Q ss_pred             hhhHHHhhhccccchHHHHHHHHHHHHHHHhhc
Q 011449           34 LDLQFARKESRTVDVSLLEEQVHQMLREWKAEL   66 (485)
Q Consensus        34 ~~LQ~ARKEsRs~D~avLEeQvhQmLREWkAEL   66 (485)
                      .++..-+.|.. .|   +.+|+++||+.|+..=
T Consensus        30 ~dI~~i~~e~p-~~---~~~q~~~lL~~W~~r~   58 (84)
T cd08803          30 DEINQIRVENP-NS---LIAQSFMLLKKWVTRD   58 (84)
T ss_pred             HHHHHHHHhCC-CC---HHHHHHHHHHHHHHhh
Confidence            34444455544 33   6799999999999853


No 20 
>PF11464 Rbsn:  Rabenosyn Rab binding domain;  InterPro: IPR021565  Rabenosyn-5 (Rbsn) is a multivalent effector with interacts with the Rab family.Rsbn contains distinct Rab4 and Rab5 binding sites within residues 264-500 and 627-784 respectively []. Rab proteins are GTPases involved in the regulation of all stages of membrane trafficking []. ; PDB: 1Z0K_B 1YZM_A 1Z0J_B.
Probab=31.28  E-value=60  Score=24.96  Aligned_cols=28  Identities=25%  Similarity=0.326  Sum_probs=21.4

Q ss_pred             hhhHHHhhhccccchHHHHHHHHHHHHH
Q 011449           34 LDLQFARKESRTVDVSLLEEQVHQMLRE   61 (485)
Q Consensus        34 ~~LQ~ARKEsRs~D~avLEeQvhQmLRE   61 (485)
                      +-++.||+.+|--+|+.||+-+++.=+|
T Consensus        10 ~~I~qAk~~~r~dEV~~L~~NL~EL~~e   37 (42)
T PF11464_consen   10 SYIKQAKAARRFDEVATLEENLRELQDE   37 (42)
T ss_dssp             HHHHHHHHTT-HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhcCcHHHHHHHHHHHHHHHH
Confidence            3478899999999999999876655444


No 21 
>TIGR02132 phaR_Bmeg polyhydroxyalkanoic acid synthase, PhaR subunit. This model describes a protein, PhaR, localized to polyhydroxyalkanoic acid (PHA) inclusion granules in Bacillus cereus and related species. PhaR is required for PHA biosynthesis along with PhaC and may be a regulatory subunit.
Probab=29.79  E-value=72  Score=31.16  Aligned_cols=41  Identities=20%  Similarity=0.247  Sum_probs=29.5

Q ss_pred             HhhhhhhhhHHhhhhhHHHhh---hccc----------cchHHHHHHHHHHHHH
Q 011449           21 KAKTRVDDLQGKFLDLQFARK---ESRT----------VDVSLLEEQVHQMLRE   61 (485)
Q Consensus        21 kak~rVdDLQ~mF~~LQ~ARK---EsRs----------~D~avLEeQvhQmLRE   61 (485)
                      +..+|||+|++.|.++=-++.   |.++          .|+.-||+-|.|||+-
T Consensus        83 nlE~kvD~lee~fdd~~d~l~~q~eq~~~~~~~v~~~~q~~~~l~~K~D~~L~l  136 (189)
T TIGR02132        83 NLEEKVDLIEEFFDDKFDELEAQQEQAPALKKDVTKLKQDIKSLDKKLDKILEL  136 (189)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhCchHHhHHHHHHHHHHHHHHHHHHHHHH
Confidence            457899999999988533332   3333          3788889999999974


No 22 
>PF02840 Prp18:  Prp18 domain;  InterPro: IPR004098 The splicing factor Prp18 is required for the second step of pre-mRNA splicing. PRP18 appears to be primarily associated with the U5 snRNP. The structure of a large fragment of the Saccharomyces cerevisiae Prp18 is known []. This fragment is fully active in yeast splicing in vitro and includes the sequences of Prp18 that have been evolutionarily conserved. The core structure consists of five alpha-helices that adopt a novel fold. The most highly conserved region of Prp18, a nearly invariant stretch of 19 aa, forms part of a loop between two alpha-helices and may interact with the U5 small nuclear ribonucleoprotein particles [].; GO: 0008380 RNA splicing, 0005681 spliceosomal complex; PDB: 1DVK_A.
Probab=29.33  E-value=53  Score=30.42  Aligned_cols=40  Identities=20%  Similarity=0.390  Sum_probs=24.1

Q ss_pred             HHHHHHHHHhhcCCCCCC--cccccCCCCc--cc---hhHHHHHhhhh
Q 011449           55 VHQMLREWKAELHEPSPA--SSLQQDGSLG--FS---SDIYRLLQLCE   95 (485)
Q Consensus        55 vhQmLREWkAEL~~pSPA--sSLQ~g~slg--fs---sd~~rLLQl~E   95 (485)
                      ++.+|+||..+|+..+.+  .|.| |....  +.   .++..|+.+++
T Consensus         5 ~k~lL~eW~~~l~~r~~~~k~s~~-gk~~~~~~~qtk~~l~PL~~~Lk   51 (144)
T PF02840_consen    5 IKFLLKEWEEELNSRPEEEKRSAQ-GKQASATYKQTKRYLKPLFKKLK   51 (144)
T ss_dssp             HHHHHHHHHHCCCCS-CC-------------CHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCChhhhhhhh-hhhhHHHHHHHHHHHHHHHHHHH
Confidence            678999999999998888  4442 22211  22   67777888774


No 23 
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]
Probab=28.43  E-value=78  Score=39.10  Aligned_cols=156  Identities=28%  Similarity=0.348  Sum_probs=89.2

Q ss_pred             CCCCchhh--HHHHHhhhcCCccCCcccccccccCCCCCcccccccccccchhhhhhhcccccc--hhhcccCccccCCC
Q 011449          262 IGLKDGLL--FAALSARAQGKDVGIPECEGAATAKSPWNAPELFDLSVLEGETIREWLFFDKPR--RAFESGNRKQRSLP  337 (485)
Q Consensus       262 I~LKDg~L--FaAL~Ak~qgk~VGiP~CeGaat~KsPWNApelFdl~~legetirewlFFDkPR--RAfeSGnRkQRslp  337 (485)
                      ||.|.+-.  |++.- |.+|+-|-.|+      -|||||+=|--+-.+     ---|=||-.-|  |--..+.--+|+|-
T Consensus      1694 idtkgnkiagFdsi~-kK~Glqvstkq------k~spwdlFEg~k~~a-----plsW~wFgTvRvDrrv~~~eeq~rlll 1761 (2220)
T KOG3598|consen 1694 IDTKGNKIAGFDSIE-KKNGLQVSTKQ------KKSPWDLFEGTKHLA-----PLSWKWFGTVRVDRRVKNVEEQLRLLL 1761 (2220)
T ss_pred             cccccceeccchhhh-hhcCceecccc------ccCcchhhccCCCCC-----CccceeeeeeehhHHHHhHHHHHHHHH
Confidence            67776654  88887 99999999887      689999876655442     22488887665  22233333444431


Q ss_pred             CCCCCchhhhHHHHHHHhcCcccccccCCCCCCCcceeeeEEeecccccceeeeeeeeeccCccCcCcccccchHHHHHH
Q 011449          338 DYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYRLELKLVDGKKSAKGKLANDSVADLQK  417 (485)
Q Consensus       338 DY~gRGWhESRKqvMke~gGlkrSYYMDPQP~~~~eWHlyEYein~~dacALYRLElK~~d~kks~K~K~~~~sla~lQ~  417 (485)
                      -      |-   -||    -.-|+||..|+|+-.-+    |=|--+       -+|-|-.-.|+..+...        ..
T Consensus      1762 y------HT---H~~----p~pR~yyL~PlPlPped----EEe~~~-------~~~e~e~~~~e~~s~~~--------~d 1809 (2220)
T KOG3598|consen 1762 Y------HT---HVL----PFPRDYYLAPLPLPPED----EEEAKK-------AEEEKEAAEKEEESKNA--------ED 1809 (2220)
T ss_pred             h------hc---ccc----CCcchhhccCCCCCccc----ccCCCc-------cCccccccccCccccCc--------cc
Confidence            0      00   011    12689999999987643    111111       23333333222222111        11


Q ss_pred             HhccccccccCCCcccccccccccccccccccccccCcccccCC
Q 011449          418 QMGRLTAEFPSDNKRLVKGRAKVNAKAGVGGNIYPASNVVASTN  461 (485)
Q Consensus       418 qmgrlsa~~p~d~k~~~kgrtk~~~k~~~~gniy~~~n~~~~~n  461 (485)
                      +-..-|++---+.++..||+.+...+++-.-|+|-++-....+.
T Consensus      1810 ~~~~~t~E~KK~~~~g~K~ks~~~~~e~~~~~~~r~~p~~~~~s 1853 (2220)
T KOG3598|consen 1810 EKNKNTAENKKDTKEGEKGKSKDKEKEGEKEKCKRASPKDDVTS 1853 (2220)
T ss_pred             cCCCCchhhhccccccccCCCccccccccccCcccCCCCCCCCC
Confidence            22233455555667777888888888887777877665444443


No 24 
>PF12588 PSDC:  Phophatidylserine decarboxylase ;  InterPro: IPR022237  This domain family is found in bacteria and eukaryotes, and is approximately 140 amino acids in length. The family is found in association with PF02666 from PFAM. Phosphatidylserine decarboxylase (PSD) is an important enzyme in the synthesis of phosphatidylethanolamine in both prokaryotes and eukaryotes. 
Probab=28.23  E-value=80  Score=28.98  Aligned_cols=40  Identities=30%  Similarity=0.549  Sum_probs=28.6

Q ss_pred             HHHHHHHHHHHHHhhcCCCCCCcccccCCCCc-cchhHHHH
Q 011449           51 LEEQVHQMLREWKAELHEPSPASSLQQDGSLG-FSSDIYRL   90 (485)
Q Consensus        51 LEeQvhQmLREWkAEL~~pSPAsSLQ~g~slg-fssd~~rL   90 (485)
                      +-+|+..+|.+|.+=|.-|.-++.|-.+..-| ||.+-..-
T Consensus        98 vN~~lK~ILn~W~~fL~sp~S~~vL~~~~~~GWfs~~A~~~  138 (141)
T PF12588_consen   98 VNAQLKKILNEWGEFLSSPASRSVLNTDPPNGWFSPEALKE  138 (141)
T ss_pred             HHHHHHHHHHHHHHHcCChhhhccccCCCCCCccCHHHHHH
Confidence            35788888999999999666666773332458 98776554


No 25 
>COG0113 HemB Delta-aminolevulinic acid dehydratase [Coenzyme metabolism]
Probab=27.97  E-value=25  Score=36.57  Aligned_cols=13  Identities=46%  Similarity=1.134  Sum_probs=11.2

Q ss_pred             HhcCcccccccCCC
Q 011449          354 EFGGLKRSYYMDPQ  367 (485)
Q Consensus       354 e~gGlkrSYYMDPQ  367 (485)
                      .||+ ||+|.|||-
T Consensus       218 ~~gd-rktYQmDpa  230 (330)
T COG0113         218 KFGD-RKTYQMDPA  230 (330)
T ss_pred             ccCC-cceeccCCc
Confidence            5788 999999985


No 26 
>PF00531 Death:  Death domain;  InterPro: IPR000488 The death domain (DD) is a homotypic protein interaction module composed of a bundle of six alpha-helices. DD is related in sequence and structure to the death effector domain (DED, see IPR001875 from INTERPRO) and the caspase recruitment domain (CARD, see IPR001315 from INTERPRO), which work in similar pathways and show similar interaction properties []. DD bind each other forming oligomers. Mammals have numerous and diverse DD-containing proteins []. Within these proteins, the DD domains can be found in combination with other domains, including: CARDs, DEDs, ankyrin repeats (IPR002110 from INTERPRO), caspase-like folds, kinase domains, leucine zippers (IPR002158 from INTERPRO), leucine-rich repeats (LRR) (IPR001611 from INTERPRO), TIR domains (IPR000157 from INTERPRO), and ZU5 domains (IPR000906 from INTERPRO) []. Some DD-containing proteins are involved in the regulation of apoptosis and inflammation through their activation of caspases and NF-kappaB, which typically involves interactions with TNF (tumour necrosis factor) cytokine receptors [, ]. In humans, eight of the over 30 known TNF receptors contain DD in their cytoplasmic tails; several of these TNF receptors use caspase activation as a signalling mechanism. The DD mediates self-association of these receptors, thus giving the signal to downstream events that lead to apoptosis. Other DD-containing proteins, such as ankyrin, MyD88 and pelle, are probably not directly involved in cell death signalling. DD-containing proteins also have links to innate immunity, communicating with Toll family receptors through bipartite adapter proteins such as MyD88 [].; GO: 0005515 protein binding, 0007165 signal transduction; PDB: 3OQ9_L 3EZQ_F 1E41_A 1E3Y_A 2GF5_A 2OF5_L 3EWV_E 3G5B_A 3MOP_L 2A9I_A ....
Probab=27.42  E-value=52  Score=24.95  Aligned_cols=15  Identities=40%  Similarity=0.833  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHhh
Q 011449           51 LEEQVHQMLREWKAE   65 (485)
Q Consensus        51 LEeQvhQmLREWkAE   65 (485)
                      ..+|.++||+.|+..
T Consensus        39 ~~~~~~~~L~~W~~~   53 (83)
T PF00531_consen   39 LREQTYEMLQRWRQR   53 (83)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHh
Confidence            679999999999988


No 27 
>PF14193 DUF4315:  Domain of unknown function (DUF4315)
Probab=22.47  E-value=1.8e+02  Score=24.80  Aligned_cols=31  Identities=19%  Similarity=0.500  Sum_probs=26.7

Q ss_pred             HHHhhhhhhhhHHhhhhhHHHhhhccccchH
Q 011449           19 KDKAKTRVDDLQGKFLDLQFARKESRTVDVS   49 (485)
Q Consensus        19 kdkak~rVdDLQ~mF~~LQ~ARKEsRs~D~a   49 (485)
                      .+|+|.++.++|..+-.|....+|.-+.+++
T Consensus        10 ieK~k~Kiae~Q~rlK~Le~qk~E~EN~EIv   40 (83)
T PF14193_consen   10 IEKTKEKIAELQARLKELEAQKTEAENLEIV   40 (83)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4688899999999999999999998776654


No 28 
>PHA01513 mnt Mnt
Probab=22.09  E-value=1.6e+02  Score=25.34  Aligned_cols=41  Identities=27%  Similarity=0.448  Sum_probs=28.8

Q ss_pred             HHHhhhccccchHHHHHHHHHHHHHHHhhcCCCCCCcccccCCCCccchhHHHHHhh
Q 011449           37 QFARKESRTVDVSLLEEQVHQMLREWKAELHEPSPASSLQQDGSLGFSSDIYRLLQL   93 (485)
Q Consensus        37 Q~ARKEsRs~D~avLEeQvhQmLREWkAEL~~pSPAsSLQ~g~slgfssd~~rLLQl   93 (485)
                      +.|.+|+||.     .++|-+.|..|   |..|||.+-+        -.|..|+-+.
T Consensus        22 ~aA~~nGRSm-----NaeIv~~Le~a---l~~~~~~~g~--------~~~~~~~a~~   62 (82)
T PHA01513         22 QRAKANGRSL-----NAELVQIVQDA---LSKPSPVTGY--------RDDAERLADE   62 (82)
T ss_pred             HHHHHhCCCH-----HHHHHHHHHHH---hcCCCcchhh--------HHHHHHHHHH
Confidence            4689999995     66777888877   6678887655        4555555443


No 29 
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]
Probab=22.03  E-value=47  Score=34.20  Aligned_cols=37  Identities=32%  Similarity=0.653  Sum_probs=29.4

Q ss_pred             CCCCCccccccccccc-----------chhhhhhhccccc-chhhcccC
Q 011449          294 KSPWNAPELFDLSVLE-----------GETIREWLFFDKP-RRAFESGN  330 (485)
Q Consensus       294 KsPWNApelFdl~~le-----------getirewlFFDkP-RRAfeSGn  330 (485)
                      --|+-|||||++....           |-|+-+-+|+.-| -|+|++|.
T Consensus       201 t~pyRAPELf~vk~~~ti~ertDIWSLGCtLYa~mf~~sPfe~~~~~Gg  249 (302)
T KOG2345|consen  201 TIPYRAPELFNVKSHCTITERTDIWSLGCTLYAMMFGESPFERIYQQGG  249 (302)
T ss_pred             CCcccCchheecccCcccccccchhhhhHHHHHHHHcCCcchHHhhcCC
Confidence            4699999999986532           6677788999998 47888875


No 30 
>PF06931 Adeno_E4_ORF3:  Mastadenovirus E4 ORF3 protein;  InterPro: IPR009699 This family consists of several Mastadenovirus E4 ORF3 proteins. Early proteins E4 ORF3 and E4 ORF6 have complementary functions during viral infection. Both proteins facilitate efficient viral DNA replication, late protein expression, and prevention of concatenation of viral genomes. A unique function of E4 ORF3 is the reorganisation of nuclear structures known as PML oncogenic domains (PODs). The function of these domains is unclear, but PODs have been implicated in a number of important cellular processes, including transcriptional regulation, apoptosis, transformation, and response to interferon [].
Probab=21.96  E-value=65  Score=29.32  Aligned_cols=15  Identities=47%  Similarity=0.982  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHhh
Q 011449           51 LEEQVHQMLREWKAE   65 (485)
Q Consensus        51 LEeQvhQmLREWkAE   65 (485)
                      |.+++-|.+|+||+|
T Consensus        21 l~~~~~~Ii~~Wk~E   35 (113)
T PF06931_consen   21 LQQQLTQIIRGWKNE   35 (113)
T ss_pred             HHHHHHHHHHHHhhc
Confidence            567889999999987


No 31 
>smart00150 SPEC Spectrin repeats.
Probab=21.85  E-value=2.8e+02  Score=20.58  Aligned_cols=46  Identities=20%  Similarity=0.320  Sum_probs=28.5

Q ss_pred             hHHHHHHh---hhhhhhhHHhhhhhHHHhhhccccchHHHHHHHHHHHHHHHh
Q 011449           15 HKLFKDKA---KTRVDDLQGKFLDLQFARKESRTVDVSLLEEQVHQMLREWKA   64 (485)
Q Consensus        15 H~~fkdka---k~rVdDLQ~mF~~LQ~ARKEsRs~D~avLEeQvhQmLREWkA   64 (485)
                      |+.|+...   +.+|+.+..+-..|-..    ...++..+++.+..+-..|..
T Consensus        40 ~~~~~~e~~~~~~~v~~~~~~~~~L~~~----~~~~~~~i~~~~~~l~~~w~~   88 (101)
T smart00150       40 HEALEAELEAHEERVEALNELGEQLIEE----GHPDAEEIEERLEELNERWEE   88 (101)
T ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHHHHc----CCCcHHHHHHHHHHHHHHHHH
Confidence            55555544   34445555444444332    467888899988888888874


No 32 
>PLN03166 60S ribosomal protein L34; Provisional
Probab=21.68  E-value=48  Score=28.96  Aligned_cols=16  Identities=38%  Similarity=0.752  Sum_probs=13.7

Q ss_pred             CCcccccCCCCCCCchhh
Q 011449          215 GPKCALWDCPRPAQGVDW  232 (485)
Q Consensus       215 gPKCALWDC~RPaqG~ew  232 (485)
                      +|||+  ||+++.+|..-
T Consensus        41 ~pkC~--~cg~~L~Gi~~   56 (96)
T PLN03166         41 GPKCP--VTGKRIQGIPH   56 (96)
T ss_pred             CCcCC--CCCCccCCccC
Confidence            69998  99999999754


No 33 
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]
Probab=21.48  E-value=86  Score=33.20  Aligned_cols=45  Identities=24%  Similarity=0.267  Sum_probs=38.4

Q ss_pred             hhhhhHHhhhhhHHHhhhccccchHHHHHHHHHHHHHHHhhcCCC
Q 011449           25 RVDDLQGKFLDLQFARKESRTVDVSLLEEQVHQMLREWKAELHEP   69 (485)
Q Consensus        25 rVdDLQ~mF~~LQ~ARKEsRs~D~avLEeQvhQmLREWkAEL~~p   69 (485)
                      .||||+++-..--.+|+|.-..==+++||++...++.|+..--+|
T Consensus       293 ~iDDL~~iv~~n~~~R~~~~~~ae~iIeee~~~~~~~l~~~~~~~  337 (414)
T COG0373         293 TIDDLEEIVEENLEARKEEAAKAEAIIEEELAEFMEWLKKLEVVP  337 (414)
T ss_pred             ehhhHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchH
Confidence            489999999888889999888888899999999998888765544


No 34 
>PF00435 Spectrin:  Spectrin repeat;  InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure. These include spectrin alpha and beta subunits [, ], alpha-actinin [] and dystrophin. The spectrin repeat forms a three-helix bundle. The second helix is interrupted by proline in some sequences. The repeats are defined by a characteristic tryptophan (W) residue at position 17 in helix A and a leucine (L) at 2 residues from the carboxyl end of helix C.; GO: 0005515 protein binding; PDB: 1HCI_A 1QUU_A 3FB2_B 1S35_A 1U5P_A 1U4Q_A 1CUN_B 1YDI_B 3EDV_A 1AJ3_A ....
Probab=20.49  E-value=3.6e+02  Score=19.96  Aligned_cols=49  Identities=20%  Similarity=0.358  Sum_probs=28.6

Q ss_pred             hHHHHHHhhhhhhhhHHhhhhhHHHhhhccccchHHHHHHHHHHHHHHHh
Q 011449           15 HKLFKDKAKTRVDDLQGKFLDLQFARKESRTVDVSLLEEQVHQMLREWKA   64 (485)
Q Consensus        15 H~~fkdkak~rVdDLQ~mF~~LQ~ARKEsRs~D~avLEeQvhQmLREWkA   64 (485)
                      |+.|......+-..|..+..--+.- .+....+...+.+.+.++-..|.+
T Consensus        43 ~~~~~~ei~~~~~~l~~l~~~~~~L-~~~~~~~~~~i~~~~~~l~~~w~~   91 (105)
T PF00435_consen   43 HKELQEEIESRQERLESLNEQAQQL-IDSGPEDSDEIQEKLEELNQRWEA   91 (105)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHH-HHTTHTTHHHHHHHHHHHHHHHHH
T ss_pred             HhhhhhHHHHHHHHHHHHHHHHHHH-HHcCCCcHHHHHHHHHHHHHHHHH
Confidence            5666655544444444444333333 233377788888888888777764


No 35 
>PRK04059 rpl34e 50S ribosomal protein L34e; Validated
Probab=20.28  E-value=53  Score=28.39  Aligned_cols=16  Identities=44%  Similarity=0.831  Sum_probs=13.7

Q ss_pred             CCcccccCCCCCCCchhh
Q 011449          215 GPKCALWDCPRPAQGVDW  232 (485)
Q Consensus       215 gPKCALWDC~RPaqG~ew  232 (485)
                      +|||+  ||+.+.+|.--
T Consensus        34 ~pkC~--~c~~~L~Gi~~   49 (88)
T PRK04059         34 KAKCA--ICGKPLNGVPR   49 (88)
T ss_pred             CCcCC--CCCCccCCccC
Confidence            69997  99999999744


No 36 
>PF05596 Taeniidae_ag:  Taeniidae antigen;  InterPro: IPR008860 This family consists of several antigen proteins from Taenia and Echinococcus (tapeworm) species.
Probab=20.18  E-value=34  Score=28.01  Aligned_cols=20  Identities=25%  Similarity=0.496  Sum_probs=18.2

Q ss_pred             hHHHHHHHhcCcccccccCC
Q 011449          347 SRKQVMNEFGGLKRSYYMDP  366 (485)
Q Consensus       347 SRKqvMke~gGlkrSYYMDP  366 (485)
                      -+|.|||..|=.++.||.||
T Consensus         8 ~~k~~kK~i~~v~~FF~~DP   27 (64)
T PF05596_consen    8 DKKSVKKWIEEVRNFFYEDP   27 (64)
T ss_pred             hHHhHHHHHHHHHHHhccCc
Confidence            36889999999999999998


Done!