Citrus Sinensis ID: 011449


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-----
MVGKGAKTNCKSASHKLFKDKAKTRVDDLQGKFLDLQFARKESRTVDVSLLEEQVHQMLREWKAELHEPSPASSLQQDGSLGFSSDIYRLLQLCEEEDDATSTLTAPKPEPNDQVLPVADTAVYHEGYGVNQGEQQHSFPLVDQCKNSSSGVHSTAINNLEGSTLLDYHHFDLHQEFEQNFYAGYNVSNFCGEDAMQQISGYLPGICPPPSAFLGPKCALWDCPRPAQGVDWYQDYCSGFHAALAFSEGPPGMGPVLRPGGIGLKDGLLFAALSARAQGKDVGIPECEGAATAKSPWNAPELFDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYRLELKLVDGKKSAKGKLANDSVADLQKQMGRLTAEFPSDNKRLVKGRAKVNAKAGVGGNIYPASNVVASTNEKFDYGPTGQFDYLIENLSEYYLT
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHcccccccHcccccccccccccccccccHHHHHHHHHHHccccccccccccccccccEEEEEEEEccccccEEEEEEEEcccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccc
***********************TRVDDLQGKFLDLQFARK**RTVDVSLLEEQVHQMLREWK********************SSDIYRLLQLC*********************LPVADTAVYHEGYGVN***QQHSFPLVDQCKN*****HSTAINNLEGSTLLDYHHFDLHQEFEQNFYAGYNVSNFCGEDAMQQISGYLPGICPPPSAFLGPKCALWDCPRPAQGVDWYQDYCSGFHAALAFSEGPPGMGPVLRPGGIGLKDGLLFAALSARAQGKDVGIPECEGAATAKSPWNAPELFDLSVLEGETIREWLFFDKPR****************SGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYRLELKLVD*****************QKQMG*****************************I*****VVASTNEKFDYGPTGQFDYLIENLSEYYL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGKGAKTNCKSASHKLFKDKAKTRVDDLQGKFLDLQFARKESRTVDVSLLEEQVHQMLREWKAELHEPSPASSLQQDGSLGFSSDIYRLLQLCEEEDDATSTLTAPKPEPNDQVLPVADTAVYHEGYGVNQGEQQHSFPLVDQCKNSSSGVHSTAINNLEGSTLLDYHHFDLHQEFEQNFYAGYNVSNFCGEDAMQQISGYLPGICPPPSAFLGPKCALWDCPRPAQGVDWYQDYCSGFHAALAFSEGPPGMGPVLRPGGIGLKDGLLFAALSARAQGKDVGIPECEGAATAKSPWNAPELFDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYRLELKLVDGKKSAKGKLANDSVADLQKQMGRLTAEFPSDNKRLVKGRAKVNAKAGVGGNIYPASNVVASTNEKFDYGPTGQFDYLIENLSEYYLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor VOZ1 Transcriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner.confidentQ9SGQ0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UT7, chain A
Confidence level:confident
Coverage over the Query: 265-396
View the alignment between query and template
View the model in PyMOL