Query         011479
Match_columns 484
No_of_seqs    51 out of 53
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 01:49:28 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/011479.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/011479hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03494 Beta-APP:  Beta-amyloi  22.0      59  0.0013   24.9   1.5   11  363-373    22-32  (39)
  2 PHA01732 proline-rich protein   21.0 1.6E+02  0.0034   26.3   4.1    7   60-66     61-67  (94)
  3 KOG3671 Actin regulatory prote  15.8 1.6E+03   0.036   25.6  14.7   52  261-324   442-493 (569)
  4 PF00164 Ribosom_S12_S23:  Ribo  15.5 1.5E+02  0.0033   27.3   3.0   38  432-470    62-102 (122)
  5 cd00102 IPT Immunoglobulin-lik  13.1 1.6E+02  0.0035   22.7   2.1   20  355-374    15-36  (89)
  6 KOG3671 Actin regulatory prote  12.3 7.3E+02   0.016   28.2   7.4    8   14-21    369-376 (569)
  7 KOG1924 RhoA GTPase effector D  11.1   6E+02   0.013   30.6   6.5    7  432-438   827-833 (1102)
  8 COG4815 Uncharacterized protei  11.0 2.1E+02  0.0046   27.2   2.6   33  337-369    60-92  (145)
  9 cd01180 IPT_plexin_repeat1 Fir  10.8 1.5E+02  0.0033   24.6   1.5   18  354-371    14-31  (94)
 10 KOG1690 emp24/gp25L/p24 family  10.4 1.3E+02  0.0028   30.3   1.0   64  281-352    27-91  (215)

No 1  
>PF03494 Beta-APP:  Beta-amyloid peptide (beta-APP);  InterPro: IPR013803 Amyloid-beta precursor protein (APP, or A4) is associated with Alzheimer's disease (AD), because one of its breakdown products, amyloid-beta (A-beta), aggregates to form amyloid or senile plaques [, ]. Mutations in APP or in proteins that process APP have been linked with early-onset, familial AD. Individuals with Down's syndrome carry an extra copy of chromosome 21, which contains the APP gene, and almost invariably develop amyloid plaques and Alzheimer's symptoms.  APP is important for the neurogenesis and neuronal regeneration, either through the intact protein, or through its many breakdown products []. APP consists of a large N-terminal extracellular region containing heparin-binding and copper-binding sites, a short hydrophobic transmembrane domain, and a short C-terminal intracellular domain. The N-terminal region is similar in structure to cysteine-rich growth factors and appears to function as a cell surface receptor, contributing to neurite growth, neuronal adhesion, axonogenesis and cell mobility []. APP acts as a kinesin I membrane receptor to mediate the axonal transport of beta-secretase and presenilin 1. The N-terminal domain can regulate neurite outgrowth through its binding to heparin and collagen I and IV, which are components of the extracellular matrix. APP is also coupled to apoptosis-inducing pathways, and is involved in copper homeostasis/oxidative stress through copper ion reduction, where copper-metallated APP induces neuronal death []. The C-terminal intracellular domain appears to be involved in transcription regulation through protein-protein interactions. APP can promote transcription activation through binding to APBB1/Tip60, and may bind to the adaptor protein FE65 to transactivate a wide variety of different promoters. APP can be processed by different sets of enzymes:    In the non-amyloidogenic (non-plaque-forming) pathway, APP is cleaved by alpha-secretase to yield a soluble N-terminal sAPP-alpha (neuroprotective) and a membrane-bound CTF-alpha. CTF-alpha is broken-down by presenilin-containing gamma-secretase to yield soluble p3 and membrane-bound AICD (nuclear signalling).  In the amyloidogenic pathway (plaque-forming), APP is broken down by beta-secretase to yield soluble sAPP-beta and membrane-bound CTF-beta. CTF-beta is broken down by gamma-secretase to yield soluble amyloid-beta and membrane-bound AICD. Amyloid-beta is required for neuronal function, but can aggregate to form amyloid plaques that seem to disrupt brain cells by clogging points of cell-cell contact.   This entry represents the amyloid-beta peptide (A-beta), which originates as a breakdown product from the cleavage of amyloid-beta precursor protein (APP, or A4), an integral, glycosylated membrane brain protein.  More information about these protein can be found at Protein of the Month: Amyloid-beta Precursor Protein [].; GO: 0005488 binding, 0016021 integral to membrane; PDB: 2LMQ_F 3JTI_B 2LMO_B 3MOQ_D 2LNQ_E 2LMP_G 2BEG_B 1AMC_A 3OW9_B 3U0T_F ....
Probab=22.04  E-value=59  Score=24.94  Aligned_cols=11  Identities=45%  Similarity=0.903  Sum_probs=9.4

Q ss_pred             ccCcceeEEEe
Q 011479          363 GENKGAFMEVI  373 (484)
Q Consensus       363 GENKGAtMev~  373 (484)
                      |.||||++.|-
T Consensus        22 gSNKGAIIGLM   32 (39)
T PF03494_consen   22 GSNKGAIIGLM   32 (39)
T ss_dssp             SSSSSEEEEEE
T ss_pred             CCCCceEEEEE
Confidence            89999998764


No 2  
>PHA01732 proline-rich protein
Probab=20.99  E-value=1.6e+02  Score=26.35  Aligned_cols=7  Identities=43%  Similarity=0.515  Sum_probs=4.6

Q ss_pred             Ccccccc
Q 011479           60 AVGVSSV   66 (484)
Q Consensus        60 a~gvaSv   66 (484)
                      +.|+|||
T Consensus        61 a~gTasL   67 (94)
T PHA01732         61 AGGTASL   67 (94)
T ss_pred             ccCccee
Confidence            3677775


No 3  
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton]
Probab=15.84  E-value=1.6e+03  Score=25.57  Aligned_cols=52  Identities=21%  Similarity=0.295  Sum_probs=25.3

Q ss_pred             CCCCCCCCCCCCCCCCcCCCCCCCCCCCccccceEEeecccCCCCCCCCCCCCCCCCCCCCCCc
Q 011479          261 ATAPPPSPLTLPPPQFTSKAETQPTIPAETEQKTVLVQTRSEKPKSWFNGTGNHFDETHKPSSY  324 (484)
Q Consensus       261 ~tapPPSpLtLPps~~ks~~e~e~kip~~~eqktvlvqk~~~~pKp~~~~~~~~~~~t~~~s~~  324 (484)
                      ...|||+.+++|+.-.-.      +.|-.+.++--|.      .....+++-+.++-|++++.-
T Consensus       442 gppPPP~~~~~Pp~~aga------~aPp~p~~~~al~------~~i~~G~ql~~ve~t~~~~~d  493 (569)
T KOG3671|consen  442 GPPPPPSAPIAPPQGAGA------AAPPAPPARPALL------DAIAPGGQLKKVETTALSSGD  493 (569)
T ss_pred             CCCCCCCccCCCCCccCC------CCCCCCCCccccc------cccCccccccceeeccCcCcc
Confidence            345667777788743321      1122222222222      233455666667767766533


No 4  
>PF00164 Ribosom_S12_S23:  Ribosomal protein S12/S23;  InterPro: IPR006032 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein S12 is one of the proteins from the small ribosomal subunit. In Escherichia coli, S12 is known to be involved in the translation initiation step. It is a very basic protein of 120 to 150 amino-acid residues. S12 belongs to a family of ribosomal proteins which are grouped on the basis of sequence similarities. This protein is known typically as S12 in bacteria, S23 in eukaryotes and as either S12 or S23 in the Archaea []. Bacterial S12 molecules contain a conserved aspartic acid residue which undergoes a novel post-translational modification, beta-methylthiolation, to form the corresponding 3-methylthioaspartic acid.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2ZKQ_l 3BBN_L 3PYU_L 3D5A_L 3MS0_L 3MR8_L 3F1G_L 2OW8_m 3PYS_L 2QNH_m ....
Probab=15.46  E-value=1.5e+02  Score=27.28  Aligned_cols=38  Identities=18%  Similarity=0.323  Sum_probs=29.8

Q ss_pred             ceeee---ccccceeecceEeeccccCCCCccEEEeccCCCC
Q 011479          432 MGAFM---NSNVQGVNNSIVFHSSCSHHDPGVHLSLSRKPSG  470 (484)
Q Consensus       432 i~ayv---NSNVQ~VNNSil~~SSc~~~DPGVHl~ls~k~~g  470 (484)
                      +.|||   ..|+|. |+-+|+.+-.-.+=|||++.+-++..|
T Consensus        62 v~AyIPg~Ghnlqe-hs~VLVrGgrv~DlPGVkykvVRG~~D  102 (122)
T PF00164_consen   62 VTAYIPGEGHNLQE-HSVVLVRGGRVGDLPGVKYKVVRGVYD  102 (122)
T ss_dssp             EEEEC-SSSCCSTT-TSEEEEEEESBTTSTTECEEBETTSTT
T ss_pred             EEEEecCCcccccc-cceEEEeccccCCCCceEEEEEeeccc
Confidence            67886   577776 666788887778889999999987643


No 5  
>cd00102 IPT Immunoglobulin-like fold, Plexins, Transcription factors (IPT). IPTs are also known as Transcription factor ImmunoGlobin (TIG) domains. They are present in intracellular transcription factors, cell surface receptors (such as plexins and scatter factor receptors), as well as, cyclodextrin glycosyltransferase and similar enzymes. Although they are involved in DNA binding in transcription factors, their function in other proteins is unknown. In these transcription factors, IPTs form homo- or heterodimers with the exception of the nuclear factor of activated Tcells (NFAT) transcription factors which are mainly monomers.
Probab=13.09  E-value=1.6e+02  Score=22.66  Aligned_cols=20  Identities=35%  Similarity=0.398  Sum_probs=15.9

Q ss_pred             ccEEEEEeccCccee--EEEec
Q 011479          355 GMRVITIAGENKGAF--MEVIR  374 (484)
Q Consensus       355 G~rVITLAGENKGAt--Mev~~  374 (484)
                      |-..|||.|+|-+..  ++|.-
T Consensus        15 GGt~itI~G~~f~~~~~~~v~~   36 (89)
T cd00102          15 GGTEVTITGSNFGSGSNLRVTF   36 (89)
T ss_pred             CCeEEEEEEECCCCCCcEEEEE
Confidence            567999999999887  55554


No 6  
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton]
Probab=12.28  E-value=7.3e+02  Score=28.19  Aligned_cols=8  Identities=50%  Similarity=0.995  Sum_probs=3.2

Q ss_pred             cCCCCCCC
Q 011479           14 LPSIGRPA   21 (484)
Q Consensus        14 ~pS~~~~a   21 (484)
                      .|+-+|+.
T Consensus       369 vPs~ar~P  376 (569)
T KOG3671|consen  369 VPSAARPP  376 (569)
T ss_pred             CCCCCCCC
Confidence            34444433


No 7  
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]
Probab=11.15  E-value=6e+02  Score=30.56  Aligned_cols=7  Identities=57%  Similarity=1.108  Sum_probs=3.5

Q ss_pred             ceeeecc
Q 011479          432 MGAFMNS  438 (484)
Q Consensus       432 i~ayvNS  438 (484)
                      ++-|||+
T Consensus       827 ~GNyMn~  833 (1102)
T KOG1924|consen  827 VGNYMNS  833 (1102)
T ss_pred             Hhccccc
Confidence            3455554


No 8  
>COG4815 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=11.02  E-value=2.1e+02  Score=27.19  Aligned_cols=33  Identities=21%  Similarity=0.404  Sum_probs=0.0

Q ss_pred             hhcccccccccCCCCCCCccEEEEEeccCccee
Q 011479          337 AKNGKVHRKQFSSDSDEVGMRVITIAGENKGAF  369 (484)
Q Consensus       337 ske~kg~~k~~ssdSeD~G~rVITLAGENKGAt  369 (484)
                      .||.-|.++.++.+.-.+|+.||.|.++|+|-+
T Consensus        60 ~rde~g~n~Pfs~~~~a~~LlI~V~de~~~G~F   92 (145)
T COG4815          60 QRDEGGQNQPFSDDGMAAGLLIFVIDEVLRGVF   92 (145)
T ss_pred             EeCCCCCcCCCCcccccCeeEEEEEccccceEE


No 9  
>cd01180 IPT_plexin_repeat1 First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.
Probab=10.85  E-value=1.5e+02  Score=24.56  Aligned_cols=18  Identities=33%  Similarity=0.353  Sum_probs=0.0

Q ss_pred             CccEEEEEeccCcceeEE
Q 011479          354 VGMRVITIAGENKGAFME  371 (484)
Q Consensus       354 ~G~rVITLAGENKGAtMe  371 (484)
                      .|-..|||-|+|-|+.|+
T Consensus        14 ~GGT~vTI~G~nl~~~~~   31 (94)
T cd01180          14 EGGTRLTICGSNLGLRKN   31 (94)
T ss_pred             CCCEEEEEEEEcCCCCcc


No 10 
>KOG1690 consensus emp24/gp25L/p24 family of membrane trafficking proteins [Intracellular trafficking, secretion, and vesicular transport]
Probab=10.44  E-value=1.3e+02  Score=30.25  Aligned_cols=64  Identities=27%  Similarity=0.225  Sum_probs=0.0

Q ss_pred             CCCCCCCCccccceEEeecccCCCCCCCCCCCCCCCCCCCCCCccCcCCcchhhh-hhhcccccccccCCCCC
Q 011479          281 ETQPTIPAETEQKTVLVQTRSEKPKSWFNGTGNHFDETHKPSSYAHRGNHEVHKE-VAKNGKVHRKQFSSDSD  352 (484)
Q Consensus       281 e~e~kip~~~eqktvlvqk~~~~pKp~~~~~~~~~~~t~~~s~~~~~~k~e~~kd-eske~kg~~k~~ssdSe  352 (484)
                      ++|.|-=++-=.|-.|| +-+-+..-|.+.+++..+       +++++-|-.+|| +.|||.+.+++.++..+
T Consensus        27 ~~e~KCF~eelpk~tmv-~G~yk~qlyd~~~~~y~~-------~p~~gm~VeV~e~fdnnh~Vl~q~~ss~G~   91 (215)
T KOG1690|consen   27 GTEKKCFIEELPKGTMV-TGNYKAQLYDDQLKGYGS-------YPNIGMHVEVKETFDNNHVVLSQQYSSEGD   91 (215)
T ss_pred             CCcccchhhhCCCCcEE-Eeeeeeeeecchhccccc-------CCCceEEEEeecCCCCceEEEeecCCCCCc


Done!