BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 011516
(484 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus
1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In
Complex With Acetoacetyl Coa
pdb|2UZF|B Chain B, Crystal Structure Of Staphylococcus Aureus
1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In
Complex With Acetoacetyl Coa
Length = 273
Score = 28.9 bits (63), Expect = 7.4, Method: Compositional matrix adjust.
Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%)
Query: 8 FVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHA 64
+VG + N L ++ PK PV+ ++KG+A GG +L V + A D+A
Sbjct: 85 YVGEDQIPRLNVLDLQRLIRIIPK---PVIAMVKGYAVGGGNVLNVVCDLTIAADNA 138
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.140 0.420
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,818,653
Number of Sequences: 62578
Number of extensions: 480514
Number of successful extensions: 1378
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1377
Number of HSP's gapped (non-prelim): 2
length of query: 484
length of database: 14,973,337
effective HSP length: 103
effective length of query: 381
effective length of database: 8,527,803
effective search space: 3249092943
effective search space used: 3249092943
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)