Citrus Sinensis ID: 011533


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480---
MASFILNFVNTMLNRVKLALDSPSAGAVVFGVHISGHLFVEVLLLVVILFLLSQKSYKPPKRPLTKKEIDELCDEWVPESLIPPIIEEMRCEPPVLESAAGPHTIISGKEVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCEARIAKFLGTPDSILYSYGLSTMFSAIPCFCKKGDLIVADEGVHWGIQNGLYLSRSTVVYFKHNDMDSLRNTLERVTADNKRAKKLRRYIVVEAVYQNSGQIAPLDELIRLKEKYRFRVFLDESNSFGVLGRSGRGLTEHCGVPVDKIDIVTAAMGHALATEGGFCTGSARVVDHQRLSSSGYVFSASLPPYLASAAITAIDVLEENPDLITKLKKNTAILRTGLSDIHGLSIASNPESPIVFLILEKSTGSMKNDLQLLEDIADWALKEDGVFVVTSKRSMLDKCRLPVGIRLFVSAAHSEADLVKACESLKRISAVVLRDRN
cHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccccccccccccccEECcccccEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccEEEEccHHHHHHcccccccccccEEEEcccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccHHHHHHHHHccEEEEEEcccccccccccccccccccccccccEEEEEcccHHHHccccccCCccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHccc
**SFILNFVNTMLNRVKLALDSPSAGAVVFGVHISGHLFVEVLLLVVILFLLSQK***********KEIDELCDEWVPESLIPPIIEEMRCEPPVLESAAGPHTIISGKEVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCEARIAKFLGTPDSILYSYGLSTMFSAIPCFCKKGDLIVADEGVHWGIQNGLYLSRSTVVYFKHNDMDSLRNTLERVTADNKRAKKLRRYIVVEAVYQNSGQIAPLDELIRLKEKYRFRVFLDESNSFGVLGRSGRGLTEHCGVPVDKIDIVTAAMGHALATEGGFCTGSARVVDHQRLSSSGYVFSASLPPYLASAAITAIDVLEENPDLITKLKKNTAILRTGLSDIHGLSIASNPESPIVFLILEKSTGSMKNDLQLLEDIADWALKEDGVFVVTSKRSMLDKCRLPVGIRLFVSAAHSEADLVKACESLKRISAVVLR***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASFILNFVNTMLNRVKLALDSPSAGAVVFGVHISGHLFVEVLLLVVILFLLSQKSYKPPKRPLTKKEIDELCDEWVPESLIPPIIEEMRCEPPVLESAAGPHTIISGKEVVNFASANYLGLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCEARIAKFLGTPDSILYSYGLSTMFSAIPCFCKKGDLIVADEGVHWGIQNGLYLSRSTVVYFKHNDxxxxxxxxxxxxxxxxxxxxxRRYIVVEAVYQNSGQIAPLDELIRLKEKYRFRVFLDESNSFGVLGRSGRGLTEHCGVPVDKIDIVTAAMGHALATEGGFCTGSARVVDHQRLSSSGYVFSASLPPYLASAAITAIDVLEENPDLITKLKKNTAILRTGLSDIHGLSIASNPESPIVFLILEKSTGSMKNDLQLLEDIADWALKEDGVFVVTSKRSMLDKCRLPVGIRLFVSAAHSEADLVKACESLKRISAVVLRDRN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Long chain base biosynthesis protein 1 Serine palmitoyltransferase (SPT). The heterodimer formed with LCB2 constitutes the catalytic core. Involved in the regulation of the programmed cell death (PCD) signaling pathway. Plays an important role during male gametogenesis and embryogenesis.confidentQ94IB8
Long chain base biosynthesis protein 1b Serine palmitoyltransferase (SPT). The heterodimer formed with LCB2 constitutes the catalytic core.confidentQ6K8E7
Long chain base biosynthesis protein 1a Serine palmitoyltransferase (SPT). The heterodimer formed with LCB2 constitutes the catalytic core.probableQ10P01

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.50Serine C-palmitoyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FC4, chain A
Confidence level:very confident
Coverage over the Query: 91-478
View the alignment between query and template
View the model in PyMOL
Template: 4ATQ, chain A
Confidence level:confident
Coverage over the Query: 67-477
View the alignment between query and template
View the model in PyMOL