Citrus Sinensis ID: 011572

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480---

MQSGSKSKCASASHQFLLDSAKNRLNDLQEKFANLRVARKEGRANDVAVLEEQVNQILREWNSELSAPSPASSLLGGSLGLFPNDIDRLLQLGDEQDDATSPLAGFAEMKPQPDVQGHPGTMMAFQEDYVVNNELQGHCFQGFDKCEDSASGLHNPTVGISGLTTQLDYSHLIFRQELENLLLDGVNGTEECEKDIGPNSLPIIHPPPSAFMGPKCALWDCTRPALGSELFEDYCSNFHATLAVSEDSPGLTPVLRPGGINLKDSLLFNAVNARAQGKRVGIPHCEGAATTKSPWNATELFDLALLEGETIREWLFFDKHRKAFESGTRKQRSLPDHSGRGWHESRKLVMKEFGGQKRSYYMDPQPSDGLEWHLYEYEIIGFDAYALYRLEVKLASEKKSPKVKVTKDSLADLQKKMGRLTADVPVDNKSSFKGKIETNGKVDSANVNSSQNEMTSATEILHHGSSSPYKYLADNSADYYHKY

ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHcccccHHHHccccccccccccccccccHHHHHHHHHHHccccccccccccccccccEEEEEEEEcccccEEEEEEEEEcccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

***********************RLNDLQEKFANLRV*******NDVAVLEEQVNQILREWN******************LFPNDIDRLL*******************************MMAFQEDYVVNNELQGHCFQGFDKCEDSASGLHNPTVGISGLTTQLDYSHLIFRQELENLLLDGVNGTEECEKDIGPNSLPIIHPPPSAFMGPKCALWDCTRPALGSELFEDYCSNFHATLAVSEDSPGLTPVLRPGGINLKDSLLFNAVNARAQGKRVGIPHCEGAATTKSPWNATELFDLALLEGETIREWLFFDKHR*****************GRGWHESRKLVMKEFGGQKRSYYMDPQPSDGLEWHLYEYEIIGFDAYALYRLEVKL**********************MG*******************************SQNEMTSATEILHHGSSSPYKYLADNS*DYYH**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQSGSKSKCASASHQFLxxxxxxxxxxxxxxxxxxxxxxxxxxxxDVAVLEEQVNQILREWNSELSAPSPASSLLGGSLGLFPNDIDRLLQLGDEQDDATSPLAGFAEMKPQPDVQGHPGTMMAFQEDYVVNNELQGHCFQGFDKCEDSASGLHNPTVGISGLTTQLDYSHLIFRQELENLLLDGVNGTEECEKDIGPNSLPIIHPPPSAFMGPKCALWDCTRPALGSELFEDYCSNFHATLAVSEDSPGLTPVLRPGGINLKDSLLFNAVNARAQGKRVGIPHCEGAATTKSPWNATELFDLALLEGETIREWLFFDKHRKAFESGTRKQRSLPDHSGRGWHESRKLVMKEFGGQKRSYYMDPQPSDGLEWHLYEYEIIGFDAYALYRLEVKLASEKKSPKVKVTKDSLADLQKKMGRLTADVPVDNKSSFKGKIETNGKVDSANVNSSQNEMTSATEILHHGSSSPYKYLADNSADYYHKY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor VOZ1	Transcriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner.	probable	Q9SGQ0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UT7, chain A
Confidence level:confident
Coverage over the Query: 263-394
View the alignment between query and template
View the model in PyMOL