Citrus Sinensis ID: 011622


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-
MPAQKRSLQESHHANNGEQLQGEEQQRQDSFQQSHAKQSRHERQQLELQQNEQQQLEEDQKDDEEVEGEGDEEDEENEDDSEGPSSDTSGEKPEFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELAFHEEERTRNKQIQASIAKIFQRQSEALVKRRTPGKDTASPFMTRPQRNPRTAHLRRRRNSRGTEHQGSEDNEDENDDNGGKDSSSNDERSAEVRPRRRKRRSGIRSSQPSSSAANSDGGCIENDLEVGRESRGISPGLVWNPEMLAWGRGGTRSNTRHGSASGCNSKSSRSTRLNKLVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKERLDAKGNQSTPIPTTDQLQILEGQETLAGLRVNHTSNTDHLILAYRQKQSR
ccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccccccccEEEEccccccccccccccEEccccccHHHHHHHHHHHccccccEEEEEEEEccccccccccccccccccEEEcccccHHHHHHHccccccccEEEEEEccccc
**********************************************************************************************FVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELA*************************************************************************************************************************************ISPGLVWNPEMLAWG****************************LVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKE******************QILEGQETLAGLRVNHTSNTDHLILAYRQK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAQKRSLQESHHANNGEQLQGEEQQRQDSFQQSHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEGEGDEEDEENEDDSEGPSSDTSGEKPEFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELAFHEEERTRNKQIQASIAKIFQRQSEALVKRRTPGKDTASPFMTRPQRNPRTAHLRRRRNSRGTEHQGSEDNEDENDDNGGKDSSSNDERSAEVRPRRRKRRSGIRSSQPSSSAANSDGGCIENDLEVGRESRGISPGLVWNPEMLAWGRGGTRSNTRHGSASGCNSKSSRSTRxxxxxxxxxxxxxxxxxxxxxLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCEYVSLQTPLQAEEVEILMVKERLDAKGNQSTPIPTTDQLQILEGQETLAGLRVNHTSNTDHLILAYRQKQSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative E3 ubiquitin-protein ligase RING1a As part of the PRC1-like complex, repress class I KNOX gene expression. PcG PRC1 complex maintains the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility.probableQ9FKW0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CKL, chain A
Confidence level:very confident
Coverage over the Query: 98-176
View the alignment between query and template
View the model in PyMOL
Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 98-189
View the alignment between query and template
View the model in PyMOL
Template: 3RUI, chain B
Confidence level:probable
Coverage over the Query: 377-478
View the alignment between query and template
View the model in PyMOL