BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 011630
         (481 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1OJ7|A Chain A, Structural Genomics, Unknown Function Crystal Structure
          Of E. Coli K-12 Yqhd
 pdb|1OJ7|B Chain B, Structural Genomics, Unknown Function Crystal Structure
          Of E. Coli K-12 Yqhd
 pdb|1OJ7|C Chain C, Structural Genomics, Unknown Function Crystal Structure
          Of E. Coli K-12 Yqhd
 pdb|1OJ7|D Chain D, Structural Genomics, Unknown Function Crystal Structure
          Of E. Coli K-12 Yqhd
          Length = 408

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 14 LFVSGRPEQPKEKAPTMSSVAMPYTGGDIKKSGELGKMFD 53
          LF  G     +E+ P  + V + Y GG +KK+G L ++ D
Sbjct: 34 LFGKGAIAGLREQIPHDARVLITYGGGSVKKTGVLDQVLD 73


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.134    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,006,905
Number of Sequences: 62578
Number of extensions: 562291
Number of successful extensions: 1100
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1099
Number of HSP's gapped (non-prelim): 1
length of query: 481
length of database: 14,973,337
effective HSP length: 103
effective length of query: 378
effective length of database: 8,527,803
effective search space: 3223509534
effective search space used: 3223509534
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)