Citrus Sinensis ID: 011709


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MDPQAPKKRGRKPKPKEDKKDEPKMKESTTTKRTAHQHAVDDKYTHWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVVKPRVAAAEHISQFNEEARSPFVKKHKTIIHPGEVNRIRELPQNTKIVATHTDSPDVLIWDVEAQPNRHAVLGATNSRPDLILTGHQDNAEFALAMCPTEPYVLSGGKDKSVVLWSIQDHITSSATDPATAKSAGSSGSIIKQSPKPGDGNDKAADGPSVGPRGIYNGHEDTVEDVTFCPSSAQEFCSVGDDSCLILWDARVGTSPVIKVEKAHDADLHCVDWNPLDDNLILTGSADNSVRMFDRRNLTSNGVGSPINKFEGHSAAVLCVQWSPDKSSVFGSSAEDGLLNIWDYEKVGKKVEQGPRTTNYPAGLFFQHAGHSPSSSIKFVLRESCLVDNNHGLSYANKKIKIYCHLEALKSFQIKKNFIFC
cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHcccccccCEEEEcccccccccccEEEEEEEEccccccccEEEEEEEEccccccccHHHccccccccccccEEEEEEEcccccEEEEEECcccccEEEEECccccEEEEEcccccccccccccccccccEEEEcccccCEEEEECcccccEEEEECccccEEEEEcccccccccccccCEEEEcccccCEEccccccccccccccccccccEEEEEccccCEEEEEEccccccEEEEECcccEEEEEEccccccccEEEEccccccEEEEEEccccccEEEEECccccEEEEEcccccccccccccEEEccccccEEEEEEccccccEEEEECccccEEEEEcccccccccccccccccccEEEEECccccccEEEEEEccccEEECcccccccccCEEEEEEEccEEEEEECcccEEEc
****************************************DDKYTHWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVVKPRVAAAEH****NE***SPFVKKHKTIIHPGEVNRIRELPQNTKIVATHTDSPDVLIWDVEAQP********TNSRPDLILTGHQDNAEFALAMCPTEPYVLSGGKDKSVVLWSIQDHITSSATDPATAKSAGSSGSIIKQSPKPGDGNDKAADGPSVGPRGIYNGHEDTVEDVTFCPSSAQEFCSVGDDSCLILWDARVGTSPVIKVEKAHDADLHCVDWNPLDDNLILTGSADNSVRMFDRRNLTSNGVGSPINKFEGHSAAVLCVQWSPDKSSVFGSSAEDGLLNIWDYEKVGKKVEQGPRTTNYPAGLFFQHAGHSPSSSIKFVLRESCLVDNNHGLSYANKKIKIYCHLEALKSFQIKKNFIFC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPQAPKKRGRKPKPKEDKKDEPKMKESTTTKRTAHQHAVDDKYTHWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQTDGSVPNTLVIANCEVVKPRVAAAEHISQFNEEARSPFVKKHKTIIHPGEVNRIRELPQNTKIVATHTDSPDVLIWDVEAQPNRHAVLGATNSRPDLILTGHQDNAEFALAMCPTEPYVLSGGKDKSVVLWSIQDHITSSATDPATAKSAGSSGSIIKQSPKPGDGNDKAADGPSVGPRGIYNGHEDTVEDVTFCPSSAQEFCSVGDDSCLILWDARVGTSPVIKVEKAHDADLHCVDWNPLDDNLILTGSADNSVRMFDRRNLTSNGVGSPINKFEGHSAAVLCVQWSPDKSSVFGSSAEDGLLNIWDYEKVGKKVEQGPRTTNYPAGLFFQHAGHSPSSSIKFVLRESCLVDNNHGLSYANKKIKIYCHLEALKSFQIKKNFIFC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD-40 repeat-containing protein MSI4 Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of the flowering autonomous pathway which positively regulates flowering by promoting transcriptional repression of the flowering repressor FLC. May promote histone deacetylation at the FLC locus leading to the formation of repressive chromatin structures. Also negatively regulates cold-responsive genes.confidentO22607
WD-40 repeat-containing protein MSI5 Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA.probableQ9SU78

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MKQ, chain A
Confidence level:very confident
Coverage over the Query: 66-109,131-173,186-230,270-405,421-464
View the alignment between query and template
View the model in PyMOL
Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 42-110,132-173,186-405,421-465
View the alignment between query and template
View the model in PyMOL
Template: 4A11, chain B
Confidence level:very confident
Coverage over the Query: 135-231,272-465
View the alignment between query and template
View the model in PyMOL
Template: 2XYI, chain A
Confidence level:very confident
Coverage over the Query: 35-109,130-232,266-466
View the alignment between query and template
View the model in PyMOL