Citrus Sinensis ID: 011712

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MTTDRRAYKIDPSNPGSDLAGETAAAMAAASIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGNQHYLDYLGKNGDSMGGTGWGMTEFGWDVKYPGVQTLVAKFLMQGKAGHYAPVFERYQQKAEYFMCSCLGKGSRNVQKTPGGLIFRQRWNNMQFVTSASFLATVYSDYLASAGRDLKCSAGNVAPAELLGFAKSQVDYILGDNPRATSYMVGYGNNYPQRVHHRASSIVSIKVNPSFVSCRGGYATWFSSKGSDPNLLVGAVVGGPDAYDNFGDRRDNYEQTEPATYNNAPILGILARLNAGHGGYNQLLPVIVPAATPVVTKPSPAPKPKTIPPTKPKTTPAPASSSGAIAIQQKLTTSWISNGKRYYRYSTIVTNKSAKTLKNLKLSISKLYGPLWGLTNLGNAYGFPSWLNNLAAGKSLEFVYIHTANAADVSVSAYTLA
cccccccEEEccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccECccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccCECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEECcccEEEEEEEEEEEccccccccccEEEEEEcccccccccccccCCcccccccccccccEEEEEEEEcccccEEEEEEEEEc
*TTDRRAYKIDPSNPGSDLAGETAAAMAAASIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGNQHYLDYLGKNGDSMGGTGWGMTEFGWDVKYPGVQTLVAKFLMQGKAGHYAPVFERYQQKAEYFMCSCLGKGSRNVQKTPGGLIFRQRWNNMQFVTSASFLATVYSDYLASAGRDLKCSAGNVAPAELLGFAKSQVDYILGDNPRATSYMVGYGNNYPQRVHHRASSIVSIKVNPSFVSCRGGYATWFSSKGSDPNLLVGAVVGGPDAYDNFGDRRDNYEQTEPATYNNAPILGILARLNAGHGGYNQLLPVI**********************************SGAIAIQQKLTTSWISNGKRYYRYSTIVTNKSAKTLKNLKLSISKLYGPLWGLTNLGNAYGFPSWLNNLAAGKSLEFVYIHTANAADVSVSAYTLA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTDRRAYKIDPSNPGSDLAGETAAAMAAASIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGNQHYLDYLGKNGDSMGGTGWGMTEFGWDVKYPGVQTLVAKFLMQGKAGHYAPVFERYQQKAEYFMCSCLGKGSRNVQKTPGGLIFRQRWNNMQFVTSASFLATVYSDYLASAGRDLKCSAGNVAPAELLGFAKSQVDYILGDNPRATSYMVGYGNNYPQRVHHRASSIVSIKVNPSFVSCRGGYATWFSSKGSDPNLLVGAVVGGPDAYDNFGDRRDNYEQTEPATYNNAPILGILARLNAGHGGYNQLLPVIVPAATPVVTKPSPAPKPKTIPPTKPKTTPAPASSSGAIAIQQKLTTSWISNGKRYYRYSTIVTNKSAKTLKNLKLSISKLYGPLWGLTNLGNAYGFPSWLNNLAAGKSLEFVYIHTANAADVSVSAYTLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Endoglucanase 6 probableQ42059
Endoglucanase 2 Hydrolyzes 1,4-beta-glycosyl linkages of 1,4-beta-glucans and 1,3-1,4-beta-glucans. Possesses broad substrate specificity for hemicelluloses of type II cell walls. Substrate preference is carboxymethyl-cellulose > 1,3-1,4-beta-glucan > lichenan > arabinoxylan > phospho-swollen cellulose > xylan > glucomannan. May participate in lateral root development.probableQ5NAT0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.4Cellulase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KS8, chain A
Confidence level:very confident
Coverage over the Query: 1-205,219-338
View the alignment between query and template
View the model in PyMOL
Template: 2XFG, chain A
Confidence level:very confident
Coverage over the Query: 1-266,281-341
View the alignment between query and template
View the model in PyMOL
Template: 1G87, chain A
Confidence level:very confident
Coverage over the Query: 1-266,281-351,366-424
View the alignment between query and template
View the model in PyMOL
Template: 1EXG, chain A
Confidence level:confident
Coverage over the Query: 385-475
View the alignment between query and template
View the model in PyMOL