BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 011748
         (478 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3PYA|A Chain A, Crystal Structure Of Ent-Copalyl Diphosphate Synthase From
           Arabidopsis Thaliana In Complex With
           (S)-15-Aza-14,15-Dihydrogeranylgeranyl Thiolodiphosphate
 pdb|3PYB|A Chain A, Crystal Structure Of Ent-Copalyl Diphosphate Synthase From
           Arabidopsis Thaliana In Complex With
           13-Aza-13,14-Dihydrocopalyl Diphosphate
 pdb|3PYB|B Chain B, Crystal Structure Of Ent-Copalyl Diphosphate Synthase From
           Arabidopsis Thaliana In Complex With
           13-Aza-13,14-Dihydrocopalyl Diphosphate
 pdb|3PYB|C Chain C, Crystal Structure Of Ent-Copalyl Diphosphate Synthase From
           Arabidopsis Thaliana In Complex With
           13-Aza-13,14-Dihydrocopalyl Diphosphate
          Length = 727

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 7/40 (17%)

Query: 352 ANAKNSDKHFTDMNDLNFLMCKAIDNPGLTPASSLRTAVI 391
           ANA+ SD HF D N         +D PG   AS L   +I
Sbjct: 535 ANARRSDHHFNDRN-------MRLDRPGSVQASRLAGVLI 567


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.133    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,976,973
Number of Sequences: 62578
Number of extensions: 550995
Number of successful extensions: 1235
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 1233
Number of HSP's gapped (non-prelim): 10
length of query: 478
length of database: 14,973,337
effective HSP length: 103
effective length of query: 375
effective length of database: 8,527,803
effective search space: 3197926125
effective search space used: 3197926125
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)