Citrus Sinensis ID: 011807


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------
MFPPAAGAAISNSTSLSEEAASVSSGTRVQDFGGLNLIASTISPQQQSQKAKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARLSANQLATTINTNGHPLHIASQNHSSSSLFPFTTTHIALTPWDPPQNPNPNRNNPNNDPHPNPLYIKSETHHFQIPPPLSSSQYFQEPQAVAATTKALITSPYQDLHMRTQPSLNASATSAHHMSATALLQKAATVGSATAAQQVHQSMGHHMTTTQLNMGELAAFNSVSHISPDAYLGFTSGNLSTWQKSDRLTRDFLGLTGDGHGDENVNGGANAGVNVRNALTYTAGLDFHPFERGRTLLRPQGFGFAEPAESETWGDC
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccHHccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccHccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccEEEEccccccccHHHHHHHHHccccccccccccccccccccEEEccccccccccHHHHHccccccHEHEEEcccccccccccccccEccHcHHHHHHHccccccEEcccccEEcccccHHHHHHHcccccccHHcccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccHHHEEEEcccccccccccccccccccccccccccccccccc
mfppaagaaisnstslseeaasvssgtrvqdfgglnliastispqqqsqkakkkrslpgnpdpdaevialspktllATNRFVCEVCnkgfqrdqnlqlhrrghnlpwklkqrsnkdiikkkayvcpepscvhhhpsralgdltgiKKHFCrkhgerkwkcekcskvYAVQSDwkahsktcgtreyrcdcgtlfsrkdsfiTHRAFCDALAEESARLSANQLATTintnghplhiasqnhsssslfpfttthialtpwdppqnpnpnrnnpnndphpnplyiksethhfqippplsssqyfqepqAVAATTKALitspyqdlhmrtqpslnasatsaHHMSATALLQKAATVGSATAAQQVHQSmghhmtttqlnmgelaafnsvshispdaylgftsgnlstwqksdrLTRDflgltgdghgdenvngganagVNVRNALtytagldfhpfergrtllrpqgfgfaepaesetwgdc
mfppaagaaisnstslseEAASVSSGTRVQDFGGLNLIASTISPQQQSQKAKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEVCNKGfqrdqnlqlhrrghnlpwklkqrsnKDIIKKKAYVCPEpscvhhhpsralgdltGIKKHFCRKhgerkwkcekcskvyavqsdwkahsktcgtreyrcDCGTLFSRKDSFITHRAFCDALAEESARLSANQLATTINTNGHPLHIASQNHSSSSLFPFTTTHIALTPWDPPQNPNPNRNNPNNDPHPNPLYIKSETHHFQIPPPLSSSQYFQEPQAVAATTKALITSPYQDLHMRTQPSLNASATSAHHMSATALLQKAATVGSATAAQQVHQSMGHHMTTTQLNMGELAAFNSVSHISPDAYLGFTSGNLSTWQKSDRLTRDFLGLTGDGHGDENVNGGANAGVNVRNALTYTAGLDFHPFERGRTLLRPQGfgfaepaesetwgdc
MFPPAAGAAISNSTSLSEEAASVSSGTRVQDFGGLNLIASTISPqqqsqkakkkRSLPGNPDPDAEVIALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARLSANQLATTINTNGHPLHIASQNHSSSSLFPFTTTHIALTPWDppqnpnpnrnnpnndphpnpLYIKSETHHFQIPPPLSSSQYFQEPQAVAATTKALITSPYQDLHMRTQPSLNasatsahhmsataLLQKAATVGSATAAQQVHQSMGHHMTTTQLNMGELAAFNSVSHISPDAYLGFTSGNLSTWQKSDRLTRDFLGLTGDGHGDEnvngganagvnvrnaLTYTAGLDFHPFERGRTLLRPQGFGFAEPAESETWGDC
******************************************************************VIALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARLSANQLATTINT****************LFPFTTTHIALT********************************************************************************************************************QLNMGELAAFNSVSHISPDAYLGFTSGNLSTWQKSDRLTRDFLGLTGDGHGDENVNGGANAGVNVRNALTYTAGLDFHPFERGRTLLRPQGFG*************
*FPPAAG*******************************************************PDAEVIALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRS****IKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARL*****************************************************************************************************************************************************************************************************LGLTG********************************************FGFAEPAE***WGD*
***************************RVQDFGGLNLIASTI******************PDPDAEVIALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARLSANQLATTINTNGHPLHIASQNHSSSSLFPFTTTHIALTPWDPPQNPNPNRNNPNNDPHPNPLYIKSETHHFQIPPPLSSSQYFQEPQAVAATTKALITSPYQDLHMRTQPSL*********MSATALLQK********************MTTTQLNMGELAAFNSVSHISPDAYLGFTSGNLSTWQKSDRLTRDFLGLTGDGHGDENVNGGANAGVNVRNALTYTAGLDFHPFERGRTLLRPQGFGFA***********
*****AGA*********************************************KRSLPGNPDPDAEVIALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARLSANQLATTI***************************************************************************************************************************ATVGS****************TTQLNMGELAAFNSVSHISPDAYLGFTS**********RLTRDFLGLTGDGHGDENVNGGANAGVNVRNALTYTAGLDFHPFERGRTLLRPQGFGFAEPAESET***C
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPPAAGAAISNSTSLSEEAASVSSGTRVQDFGGLNLIASTISPQQQSQKAKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARLSANQLATTINTNGHPLHIASQNHSSSSLFPFTTTHIALTPWDPPQNPNPNRNNPNNDPHPNPLYIKSETHHFQIPPPLSSSQYFQEPQAVAATTKALITSPYQDLHMRTQPSLNASATSAHHMSATALLQKAATVGSATAAQQVHQSMGHHMTTTQLNMGELAAFNSVSHISPDAYLGFTSGNLSTWQKSDRLTRDFLGLTGDGHGDENVNGGANAGVNVRNALTYTAGLDFHPFERGRTLLRPQGFGFAEPAESETWGDC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query477 2.2.26 [Sep-21-2011]
Q9ZWA6506 Zinc finger protein MAGPI no no 0.350 0.330 0.857 3e-90
Q9FFH3466 Zinc finger protein NUTCR no no 0.670 0.686 0.520 9e-89
Q700D2503 Zinc finger protein JACKD no no 0.379 0.359 0.783 2e-87
Q9C8N5499 Protein SENSITIVE TO PROT no no 0.303 0.290 0.335 1e-19
Q943I6522 Zinc finger protein STOP1 no no 0.291 0.266 0.346 3e-19
Q2QX40465 Zinc finger protein STAR3 no no 0.291 0.298 0.326 1e-17
Q8VWG3303 Protein TRANSPARENT TESTA no no 0.291 0.458 0.366 3e-16
O43313 823 ATM interactor OS=Homo sa yes no 0.299 0.173 0.307 9e-11
Q6P9S1 818 ATM interactor OS=Mus mus yes no 0.251 0.146 0.299 1e-09
Q5RER9617 Zinc finger protein 813 O yes no 0.362 0.280 0.262 4e-08
>sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1 Back     alignment and function desciption
 Score =  332 bits (852), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 144/168 (85%), Positives = 162/168 (96%), Gaps = 1/168 (0%)

Query: 51  AKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLK 110
            KKKR+LPGNPDP+AEVIALSPKTL+ATNRF+CE+C KGFQRDQNLQLHRRGHNLPWKLK
Sbjct: 40  VKKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLK 99

Query: 111 QRSNKDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQ 170
           QR++K++ +K+ YVCPE SCVHHHP+RALGDLTGIKKHFCRKHGE+KWKCEKC+K YAVQ
Sbjct: 100 QRTSKEV-RKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKCAKRYAVQ 158

Query: 171 SDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDALAEESARLSA 218
           SDWKAHSKTCGTREYRCDCGT+FSR+DSFITHRAFCDALAEE+ARL+A
Sbjct: 159 SDWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDALAEETARLNA 206




Probable transcription factor that regulates tissue boundaries and asymmetric cell division. Might be involved in the sequestration of 'SHORT-ROOT' to the nucleus.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FFH3|NUC_ARATH Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1 Back     alignment and function description
>sp|Q700D2|JKD_ARATH Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1 Back     alignment and function description
>sp|Q9C8N5|STOP1_ARATH Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Arabidopsis thaliana GN=STOP1 PE=2 SV=1 Back     alignment and function description
>sp|Q943I6|STOP1_ORYSJ Zinc finger protein STOP1 homolog OS=Oryza sativa subsp. japonica GN=Os01g0871200 PE=2 SV=1 Back     alignment and function description
>sp|Q2QX40|ART1_ORYSJ Zinc finger protein STAR3 OS=Oryza sativa subsp. japonica GN=STAR3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis thaliana GN=TT1 PE=2 SV=1 Back     alignment and function description
>sp|O43313|ATMIN_HUMAN ATM interactor OS=Homo sapiens GN=ATMIN PE=1 SV=2 Back     alignment and function description
>sp|Q6P9S1|ATMIN_MOUSE ATM interactor OS=Mus musculus GN=Atmin PE=2 SV=2 Back     alignment and function description
>sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query477
224082690469 predicted protein [Populus trichocarpa] 0.926 0.942 0.620 1e-151
359495453456 PREDICTED: zinc finger protein NUTCRACKE 0.932 0.975 0.643 1e-144
255559851466 nucleic acid binding protein, putative [ 0.937 0.959 0.616 1e-142
356570598460 PREDICTED: zinc finger protein NUTCRACKE 0.924 0.958 0.580 1e-134
356536786463 PREDICTED: zinc finger protein NUTCRACKE 0.878 0.904 0.567 1e-132
356503564472 PREDICTED: zinc finger protein NUTCRACKE 0.939 0.949 0.550 1e-128
356502791458 PREDICTED: zinc finger protein NUTCRACKE 0.893 0.930 0.562 1e-126
357440593524 Zinc finger protein-like protein [Medica 0.888 0.809 0.559 1e-124
449458522520 PREDICTED: zinc finger protein NUTCRACKE 0.832 0.763 0.570 1e-122
449528962486 PREDICTED: zinc finger protein NUTCRACKE 0.832 0.816 0.568 1e-122
>gi|224082690|ref|XP_002306797.1| predicted protein [Populus trichocarpa] gi|222856246|gb|EEE93793.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  542 bits (1396), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 307/495 (62%), Positives = 355/495 (71%), Gaps = 53/495 (10%)

Query: 10  ISNSTSLSEEAASVSSGTRVQDFGGLNLIASTISPQQQSQKAKKK----RSLPGNPDPDA 65
           +SNSTSLSEEA SVSSGTRVQ+FG LN +AS  SP Q  Q+ +K     RSLPGNPDPDA
Sbjct: 1   MSNSTSLSEEA-SVSSGTRVQEFGSLNPLASNFSPLQHQQQQQKIIKKKRSLPGNPDPDA 59

Query: 66  EVIALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVC 125
           EVIALSPKTLLATNRFVCE+CNKGFQRDQNLQLHRRGHNLPWKLKQR++K+I KKKAYVC
Sbjct: 60  EVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNSKEI-KKKAYVC 118

Query: 126 PEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWKAHSKTCGTREY 185
           PEP+CVHHHPSRALGDLTGIKKH+CRKHGE+KWKCEKCSK+YAVQSDWKAHSKTCGTREY
Sbjct: 119 PEPTCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCEKCSKIYAVQSDWKAHSKTCGTREY 178

Query: 186 RCDCGTLFSRKDSFITHRAFCDALAEESARLSANQLATTI-NTNGHPLHIASQNHSSSSL 244
           RCDCGTLFSRKDSF+THRAFCDALAEESARLSA+QL +T  N     L  A Q H  S  
Sbjct: 179 RCDCGTLFSRKDSFVTHRAFCDALAEESARLSAHQLISTDPNAQALLLQNALQAHPISLF 238

Query: 245 FPFTTTH---IAL-TPWDPPQNPNPNRNNPNNDPHPNPLYIKSETH-HFQIPPPLSSSQY 299
                TH   I+L +PWDPP++ NP+ NN     H NP++IK ETH HFQI         
Sbjct: 239 SAPNPTHQQQISLASPWDPPRHHNPSSNN-----HQNPVHIKPETHNHFQI-----PPLL 288

Query: 300 FQEPQAVAATTKALITSPYQDLHMRTQPSLNASATSAHHMSATALLQKAATVGSATAAQQ 359
            + P     + K L+ S +  L      +   S+ ++HH+SATALLQKAA+VG+A     
Sbjct: 289 QEPPPPALPSHKGLLASTFHSL-----SNAVTSSAASHHLSATALLQKAASVGAAQT--- 340

Query: 360 VHQSMGHHMTTTQLNMGELAA-----FNSVSHISPDAYLGFTSGNLSTWQKSDRLTRDFL 414
              S+G H   TQL+MGEL +      NS SH++        S  L+TWQKSDRLTRDFL
Sbjct: 341 ---SVG-HSQMTQLDMGELGSAGQVHVNSASHVAQGPNYNLNS--LATWQKSDRLTRDFL 394

Query: 415 GLTGD-----GHGDENVN---GGANAGVNVRNALTYTAGLDFHP---FERGRTLLRPQ-G 462
           GLTG+     GH   N N   GG NA +NVR  LTYT G+ FH     ER  +LL+P  G
Sbjct: 395 GLTGECEDHHGHAASNSNGSSGGVNASMNVREILTYTGGVGFHQQQYNERDHSLLKPHGG 454

Query: 463 FGFAEPAESETWGDC 477
           FGFA+P+ S+TWGDC
Sbjct: 455 FGFAQPSASKTWGDC 469




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359495453|ref|XP_002274683.2| PREDICTED: zinc finger protein NUTCRACKER-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255559851|ref|XP_002520944.1| nucleic acid binding protein, putative [Ricinus communis] gi|223539781|gb|EEF41361.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356570598|ref|XP_003553472.1| PREDICTED: zinc finger protein NUTCRACKER-like [Glycine max] Back     alignment and taxonomy information
>gi|356536786|ref|XP_003536915.1| PREDICTED: zinc finger protein NUTCRACKER-like [Glycine max] Back     alignment and taxonomy information
>gi|356503564|ref|XP_003520577.1| PREDICTED: zinc finger protein NUTCRACKER-like [Glycine max] Back     alignment and taxonomy information
>gi|356502791|ref|XP_003520199.1| PREDICTED: zinc finger protein NUTCRACKER-like [Glycine max] Back     alignment and taxonomy information
>gi|357440593|ref|XP_003590574.1| Zinc finger protein-like protein [Medicago truncatula] gi|355479622|gb|AES60825.1| Zinc finger protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449458522|ref|XP_004146996.1| PREDICTED: zinc finger protein NUTCRACKER-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449528962|ref|XP_004171470.1| PREDICTED: zinc finger protein NUTCRACKER-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query477
TAIR|locus:2132397402 IDD12 "AT4G02670" [Arabidopsis 0.503 0.597 0.677 1.6e-100
TAIR|locus:2205672455 IDD7 "AT1G55110" [Arabidopsis 0.488 0.512 0.689 3.8e-92
TAIR|locus:2051688516 IDD4 "indeterminate(ID)-domain 0.433 0.401 0.688 2.2e-86
TAIR|locus:2143543503 JKD "AT5G03150" [Arabidopsis t 0.364 0.345 0.786 5.9e-86
TAIR|locus:2167608466 NUC "AT5G44160" [Arabidopsis t 0.412 0.422 0.717 4.1e-85
TAIR|locus:2024193506 MGP "AT1G03840" [Arabidopsis t 0.373 0.351 0.805 8.2e-85
TAIR|locus:2173624500 IDD1 "AT5G66730" [Arabidopsis 0.480 0.458 0.636 1.7e-84
TAIR|locus:2101739452 IDD2 "AT3G50700" [Arabidopsis 0.345 0.365 0.849 1.9e-83
TAIR|locus:2051698 602 IDD5 "AT2G02070" [Arabidopsis 0.392 0.310 0.729 1.4e-82
TAIR|locus:2204503467 AT1G14580 "AT1G14580" [Arabido 0.335 0.342 0.826 2.2e-82
TAIR|locus:2132397 IDD12 "AT4G02670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 879 (314.5 bits), Expect = 1.6e-100, Sum P(2) = 1.6e-100
 Identities = 168/248 (67%), Positives = 191/248 (77%)

Query:    14 TSLSEEAASVSSGTR----VQDFGGLNLIASTISPXXXXXXXXXXRSLPGNPDPDAEVIA 69
             +SLS EA S SSG      +Q+F G + + S++            R LPGNPDPDAEVIA
Sbjct:    12 SSLSTEA-SASSGNNTLSTIQEFSGFHNVISSVCTHTETHKPKKKRGLPGNPDPDAEVIA 70

Query:    70 LSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVCPEPS 129
             LSPKTLLATNRFVCE+CNKGFQRDQNLQLHRRGHNLPWKLKQ++ K+  KKK YVCPE +
Sbjct:    71 LSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQKNTKEQQKKKVYVCPETN 130

Query:   130 CVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWKAHSKTCGTREYRCDC 189
             C HHHPSRALGDLTGIKKHFCRKHGE+KWKCEKCSK YAVQSDWKAH+K CGTR+YRCDC
Sbjct:   131 CAHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKFYAVQSDWKAHTKICGTRDYRCDC 190

Query:   190 GTLFSRKDSFITHRAFCDALAEESARLSANQLATTINTNGH-PLHIASQNHSSSSLFPFT 248
             GTLFSRKD+FITHRAFCDALAEESARL +   +   N N +   H    N SSS LF  T
Sbjct:   191 GTLFSRKDTFITHRAFCDALAEESARLHSTSSSNLTNPNPNFQGHHFMFNKSSSLLF--T 248

Query:   249 TTHIALTP 256
             ++ + + P
Sbjct:   249 SSPLFIEP 256


GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2205672 IDD7 "AT1G55110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051688 IDD4 "indeterminate(ID)-domain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143543 JKD "AT5G03150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167608 NUC "AT5G44160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024193 MGP "AT1G03840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173624 IDD1 "AT5G66730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101739 IDD2 "AT3G50700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051698 IDD5 "AT2G02070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204503 AT1G14580 "AT1G14580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query477
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.002
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
 Score = 39.7 bits (93), Expect = 0.002
 Identities = 25/112 (22%), Positives = 32/112 (28%), Gaps = 5/112 (4%)

Query: 256 PWDP-PQNPNPNRNNPNNDPHPNPLYIKSETHHFQIPPPLSSSQYFQEPQAVAATTKALI 314
           PWDP PQ P P    P   P P P                  +     P A    T AL 
Sbjct: 48  PWDPSPQAPPPVAQLPQPLPQPPPT---QALQALPAGDQQQHNTPTGSPAANPPATFALP 104

Query: 315 TSPYQDLHMRTQPSLNASATSAHHMSATALLQKAATVGSATAAQQVHQSMGH 366
             P     ++T+P           ++               A QQ+ Q  G 
Sbjct: 105 AGPAGP-TIQTEPGQLYPVQVPVMVTQNPANSPLDQPAQQRALQQLQQRYGA 155


Transcription initiation factor IIA (TFIIA) is a heterotrimer, the three subunits being known as alpha, beta, and gamma, in order of molecular weight. The N and C-terminal domains of the gamma subunit are represented in pfam02268 and pfam02751, respectively. This family represents the precursor that yields both the alpha and beta subunits. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II. Together with TFIID, TFIIA binds to the promoter region; this is the first step in the formation of a pre-initiation complex (PIC). Binding of the rest of the transcription machinery follows this step. After initiation, the PIC does not completely dissociate from the promoter. Some components, including TFIIA, remain attached and re-initiate a subsequent round of transcription. Length = 332

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 477
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.91
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.88
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.76
KOG3608467 consensus Zn finger proteins [General function pre 99.71
KOG3576267 consensus Ovo and related transcription factors [T 99.7
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.58
KOG3608467 consensus Zn finger proteins [General function pre 99.45
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.44
KOG3576267 consensus Ovo and related transcription factors [T 99.37
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.32
PLN03086567 PRLI-interacting factor K; Provisional 99.06
PLN03086567 PRLI-interacting factor K; Provisional 98.83
PHA00733128 hypothetical protein 98.81
PHA00733128 hypothetical protein 98.72
PHA0276855 hypothetical protein; Provisional 98.53
PHA0276855 hypothetical protein; Provisional 98.35
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.29
KOG3993500 consensus Transcription factor (contains Zn finger 98.16
KOG3993500 consensus Transcription factor (contains Zn finger 98.05
COG5189423 SFP1 Putative transcriptional repressor regulating 97.82
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.78
PHA0061644 hypothetical protein 97.73
PHA0073279 hypothetical protein 97.68
COG5189423 SFP1 Putative transcriptional repressor regulating 97.56
PHA0073279 hypothetical protein 97.41
PHA0061644 hypothetical protein 97.3
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.17
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.13
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.77
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.64
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.55
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.5
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.44
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 96.31
COG5048467 FOG: Zn-finger [General function prediction only] 96.2
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.06
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.02
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 95.6
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.27
smart0035526 ZnF_C2H2 zinc finger. 95.11
COG5048467 FOG: Zn-finger [General function prediction only] 95.07
PRK04860160 hypothetical protein; Provisional 94.69
PRK04860160 hypothetical protein; Provisional 94.66
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 94.31
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.24
COG5236493 Uncharacterized conserved protein, contains RING Z 94.11
KOG1146 1406 consensus Homeobox protein [General function predi 93.46
smart0035526 ZnF_C2H2 zinc finger. 93.32
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 93.18
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.14
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.05
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 92.53
COG5236493 Uncharacterized conserved protein, contains RING Z 92.34
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 91.84
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 89.71
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 88.76
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 88.51
KOG1146 1406 consensus Homeobox protein [General function predi 88.2
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 87.47
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 83.99
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 83.82
KOG2893341 consensus Zn finger protein [General function pred 83.04
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 82.56
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 80.5
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.91  E-value=8.8e-25  Score=209.73  Aligned_cols=122  Identities=22%  Similarity=0.478  Sum_probs=61.4

Q ss_pred             CceecCCCCccccChhHHHHHHhhcCCCccccccccccccccCcccCCCCCCCCCCCCCcccCchhhhhhhhhccccccc
Q 011807           79 NRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKW  158 (477)
Q Consensus        79 k~~~C~~Cgk~F~~~~~L~~H~r~H~~p~~c~~~~~~~~~~~k~~~C~~C~C~~~~~~k~F~~~~~L~~H~r~Htgekpf  158 (477)
                      ..|+|.+|||.|.+..+|.+|..+|..-           ...+.+.|++|       +|.|.....|+.|+|+|+  -++
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~-----------~s~ka~~C~~C-------~K~YvSmpALkMHirTH~--l~c  188 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSL-----------DSKKAFSCKYC-------GKVYVSMPALKMHIRTHT--LPC  188 (279)
T ss_pred             Cceeccccccccccccccchhhcccccc-----------cccccccCCCC-------CceeeehHHHhhHhhccC--CCc
Confidence            3455555555555555555555555300           12344555555       555555555555555554  345


Q ss_pred             cccccccccCChhHhhhhhcc-cCCcceecC-CCCcccChhHHHHHHHH-----------hhhhhcChHHHHHHH
Q 011807          159 KCEKCSKVYAVQSDWKAHSKT-CGTREYRCD-CGTLFSRKDSFITHRAF-----------CDALAEESARLSANQ  220 (477)
Q Consensus       159 ~C~~C~K~F~~~s~L~~H~r~-~gekpy~C~-Cgk~F~~~~~L~~H~~~-----------C~k~f~~~~~L~~H~  220 (477)
                      +|.+|||.|.+..-|+.|+|+ +|||||.|. |+|.|..+++|+.|+.+           |+|.|..++.|.+|.
T Consensus       189 ~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  189 ECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             ccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhh
Confidence            555555555555555555555 455555555 55555555555555543           555555555555554



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query477
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-07
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 53.9 bits (128), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 41/152 (26%), Positives = 69/152 (45%), Gaps = 23/152 (15%) Query: 68 IALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGH--NLPWK-------LKQRSN---- 114 +A +T + C C K F ++L H+R H P+K QR+N Sbjct: 37 LAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAH 96 Query: 115 -KDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDW 173 + +K Y CPE C ++ L ++ H GE+ +KC +C K ++ + + Sbjct: 97 QRTHTGEKPYACPE--C-----GKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNL 149 Query: 174 KAHSKT-CGTREYRC-DCGTLFSRKDSFITHR 203 H +T G + Y+C +CG FSR+D+ H+ Sbjct: 150 HTHQRTHTGEKPYKCPECGKSFSRRDALNVHQ 181
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query477
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-04
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 2e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-04
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
 Score = 50.6 bits (122), Expect = 4e-08
 Identities = 32/129 (24%), Positives = 54/129 (41%), Gaps = 27/129 (20%)

Query: 81  FVCE--VCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVCPEPSCVHHHPSRA 138
           F+C    CNK + +  +LQ+H R H                +K Y C    C      R 
Sbjct: 7   FMCAYPGCNKRYFKLSHLQMHSRKHT--------------GEKPYQCDFKDC-----ERR 47

Query: 139 LGDLTGIKKHFCRKH-GERKWKCEKCSKVYAVQSDWKAHSKT-CGTREYRC---DCGTLF 193
                 +K+H  R+H G + ++C+ C + ++     K H++T  G + + C    C   F
Sbjct: 48  FSRSDQLKRHQ-RRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKF 106

Query: 194 SRKDSFITH 202
           +R D  + H
Sbjct: 107 ARSDELVRH 115


>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query477
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.93
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.88
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.87
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.85
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.84
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.84
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.82
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.8
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.79
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.78
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.74
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.72
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.71
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.7
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.69
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.69
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.69
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.68
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.65
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.65
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.65
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.64
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.64
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.63
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.63
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.62
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.61
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.6
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.6
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.6
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.56
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.55
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.53
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.51
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.51
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.5
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.49
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.48
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.48
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.45
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.45
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.45
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.42
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.41
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.41
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.39
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.39
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.36
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.35
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.35
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.33
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.33
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.33
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.32
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.31
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.3
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.29
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.27
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.25
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.25
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.24
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.23
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.23
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.2
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.19
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.18
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.16
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.14
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.1
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.1
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.03
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.02
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.01
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.01
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.0
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.99
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.99
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.97
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.96
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.95
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.95
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.95
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.92
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.91
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.9
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.9
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.89
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.88
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.87
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.87
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.86
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.85
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.85
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.84
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.84
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.84
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.84
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.84
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.83
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.83
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.83
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.83
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.83
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.83
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.83
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.82
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.81
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.81
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.81
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.81
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.8
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.8
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.78
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.78
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.78
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.77
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.76
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.76
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.7
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.7
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.7
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.68
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.67
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.67
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.67
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.67
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.66
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.66
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.66
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.66
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.66
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.66
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.66
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.65
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.64
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.64
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.63
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.63
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.62
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.62
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.61
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.6
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.6
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.59
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.59
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.59
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.59
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.58
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.58
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.58
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.58
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.58
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.57
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.57
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.57
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.56
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.54
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.54
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.54
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.5
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.49
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.49
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.4
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.39
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.38
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.37
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.29
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.24
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.23
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.1
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.06
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.04
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.03
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.03
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.0
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.96
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.96
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.96
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.9
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.89
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.88
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.87
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.87
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.85
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.84
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.83
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.82
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.79
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.79
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.75
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.73
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.72
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.71
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.69
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.68
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.66
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.65
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.56
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.56
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.55
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.54
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.53
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.53
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.64
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.48
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.48
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.45
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.57
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.42
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.41
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.39
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.39
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.38
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.38
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.37
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.48
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.36
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.36
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.45
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.33
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.31
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.31
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.3
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.3
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.28
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.27
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.34
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.32
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.12
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.04
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.95
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.74
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.44
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.05
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.89
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.67
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.32
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.47
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.44
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 93.23
2e72_A49 POGO transposable element with ZNF domain; zinc fi 90.43
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 89.62
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 87.44
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.94  E-value=3e-27  Score=219.47  Aligned_cols=154  Identities=26%  Similarity=0.528  Sum_probs=110.3

Q ss_pred             hhcCccccCCCCceecCCCCccccChhHHHHHHhhcCCCccccccccccccccCcccCCCCCCCCCCCCCcccCchhhhh
Q 011807           68 IALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSNKDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKK  147 (477)
Q Consensus        68 ~~~~~~~~~~~k~~~C~~Cgk~F~~~~~L~~H~r~H~~p~~c~~~~~~~~~~~k~~~C~~C~C~~~~~~k~F~~~~~L~~  147 (477)
                      +..+...+.++++|.|.+|++.|.....|..|++.|.              ++++|.|++|       ++.|.....|..
T Consensus         9 l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~--------------~~~~~~C~~C-------~~~f~~~~~l~~   67 (190)
T 2i13_A            9 SVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHT--------------GEKPYKCPEC-------GKSFSDKKDLTR   67 (190)
T ss_dssp             ----------------------CCSSHHHHHGGGCC-----------------CCEECTTT-------CCEESSHHHHHH
T ss_pred             chhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcC--------------CCCCccCCCc-------CchhCCHHHHHH
Confidence            4455667777888888888888888888888888887              7788888888       888888888888


Q ss_pred             hhhhccccccccccccccccCChhHhhhhhcc-cCCcceecC-CCCcccChhHHHHHHHH-----------hhhhhcChH
Q 011807          148 HFCRKHGERKWKCEKCSKVYAVQSDWKAHSKT-CGTREYRCD-CGTLFSRKDSFITHRAF-----------CDALAEESA  214 (477)
Q Consensus       148 H~r~Htgekpf~C~~C~K~F~~~s~L~~H~r~-~gekpy~C~-Cgk~F~~~~~L~~H~~~-----------C~k~f~~~~  214 (477)
                      |++.|+++++|+|++|++.|.....|..|+++ +++++|.|+ |++.|.+...|..|+++           |++.|....
T Consensus        68 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  147 (190)
T 2i13_A           68 HQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSRED  147 (190)
T ss_dssp             HHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHH
T ss_pred             HHHhcCCCCCccCcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHH
Confidence            88888888888888888888888888888888 788888888 88888888888888874           888888888


Q ss_pred             HHHHHHHHhccCCCCCcccCCCCCCCCCCCC
Q 011807          215 RLSANQLATTINTNGHPLHIASQNHSSSSLF  245 (477)
Q Consensus       215 ~L~~H~~~h~~~~~~k~~~C~~C~~~fss~~  245 (477)
                      .|..|+++|   .++++|.|.+|++.|....
T Consensus       148 ~L~~H~~~H---~~~~~~~C~~C~~~f~~~~  175 (190)
T 2i13_A          148 NLHTHQRTH---TGEKPYKCPECGKSFSRRD  175 (190)
T ss_dssp             HHHHHHHHH---HCCCCEECTTTCCEESSHH
T ss_pred             HHHHHHHhc---CCCCCeECCCCCCccCCHH
Confidence            888888876   4678899999988887543



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query477
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.38
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.28
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.95
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.88
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.85
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.82
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.79
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.76
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.7
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.66
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.57
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.54
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.53
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.53
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.49
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.48
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.45
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.44
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.39
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.39
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.35
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.32
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.32
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.28
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.26
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.23
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.2
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.15
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.07
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.04
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.03
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.99
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.99
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.98
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.81
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.73
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.73
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.69
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.65
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.63
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.61
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.44
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.36
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.3
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.29
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.29
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.08
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.81
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.8
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.61
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.57
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.53
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.43
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.29
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.27
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.21
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.19
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.19
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.11
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.1
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.07
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.79
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.78
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 95.69
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.68
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.67
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.67
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.63
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.37
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.3
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.11
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.1
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.05
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.03
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.87
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.79
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.5
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.36
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.23
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.09
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.06
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.69
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 93.67
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 93.61
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.57
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.53
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.53
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.13
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.02
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 91.72
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 91.09
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 90.79
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.73
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.07
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 88.49
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 87.97
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 87.6
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 85.81
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 85.14
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.05
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 82.67
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 82.59
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 80.75
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.38  E-value=5.5e-14  Score=102.25  Aligned_cols=52  Identities=21%  Similarity=0.467  Sum_probs=32.9

Q ss_pred             cCcccCCCCCCCCCCCCCcccCchhhhhhhhhccccccccccccccccCChhHhhhhhcc
Q 011807          120 KKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWKAHSKT  179 (477)
Q Consensus       120 ~k~~~C~~C~C~~~~~~k~F~~~~~L~~H~r~Htgekpf~C~~C~K~F~~~s~L~~H~r~  179 (477)
                      ||+|.|+ |       ++.|.....|..|+++|+++|||+|.+|++.|...+.|.+|+++
T Consensus         1 EK~y~C~-C-------gk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1           1 DKLYPCQ-C-------GKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             CCCEECT-T-------SCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             CcCCCCC-C-------CCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence            3566663 5       66666666666666666666666666666666666666666654



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure