Query         011834
Match_columns 476
No_of_seqs    30 out of 32
Neff          2.1 
Searched_HMMs 46136
Date          Fri Mar 29 05:44:33 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/011834.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/011834hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist  95.8 0.00036 7.9E-09   58.8  -4.8  100  262-372    17-128 (129)
  2 cd08780 Death_TRADD Death Doma  91.0    0.15 3.2E-06   44.1   2.1   14   51-64     47-60  (90)
  3 cd08313 Death_TNFR1 Death doma  87.0    0.43 9.3E-06   39.6   2.1   17   50-66     37-53  (80)
  4 cd08319 Death_RAIDD Death doma  84.6    0.68 1.5E-05   38.5   2.1   17   51-67     41-57  (83)
  5 cd08777 Death_RIP1 Death Domai  77.4     1.8 3.9E-05   35.9   2.2   15   51-65     42-56  (86)
  6 cd08316 Death_FAS_TNFRSF6 Deat  75.1     2.1 4.5E-05   36.7   2.1   15   51-65     48-62  (97)
  7 cd08784 Death_DRs Death Domain  72.8     3.7 8.1E-05   33.2   2.9   30   33-65     23-52  (79)
  8 cd08779 Death_PIDD Death Domai  72.3     2.8 6.1E-05   34.6   2.1   16   51-66     41-56  (86)
  9 cd08318 Death_NMPP84 Death dom  68.0     5.9 0.00013   32.5   3.1   29   34-67     33-61  (86)
 10 cd08804 Death_ank2 Death domai  64.6     5.2 0.00011   33.0   2.2   15   51-65     43-57  (84)
 11 cd08306 Death_FADD Fas-associa  64.0     5.3 0.00011   32.9   2.1   15   51-65     41-55  (86)
 12 cd08315 Death_TRAILR_DR4_DR5 D  63.5       5 0.00011   33.9   2.0   15   52-66     47-61  (96)
 13 cd08317 Death_ank Death domain  48.2      15 0.00033   29.7   2.3   14   52-65     44-57  (84)
 14 smart00005 DEATH DEATH domain,  41.5      22 0.00047   27.8   2.2   15   51-65     45-59  (88)
 15 cd08805 Death_ank1 Death domai  38.8      25 0.00054   29.5   2.3   15   51-65     43-57  (84)
 16 cd08815 Death_TNFRSF25_DR3 Dea  38.4      19 0.00042   30.5   1.6   20   47-66     34-53  (77)
 17 COG0113 HemB Delta-aminolevuli  35.3      16 0.00034   38.0   0.7   13  345-358   218-230 (330)
 18 cd01670 Death Death Domain: a   32.7      50  0.0011   25.1   2.9   17   51-67     37-53  (79)
 19 PF11464 Rbsn:  Rabenosyn Rab b  30.8      62  0.0013   24.9   3.0   28   34-61     10-37  (42)
 20 cd08311 Death_p75NR Death doma  30.7      34 0.00074   28.2   1.8   13   53-65     40-52  (77)
 21 cd08803 Death_ank3 Death domai  30.5      41 0.00088   28.1   2.2   29   34-66     30-58  (84)
 22 TIGR02132 phaR_Bmeg polyhydrox  29.2      74  0.0016   31.1   4.0   41   21-61     83-136 (189)
 23 PF02840 Prp18:  Prp18 domain;   26.9      56  0.0012   30.3   2.7   40   55-95      5-51  (144)
 24 PF00531 Death:  Death domain;   26.2      56  0.0012   24.8   2.2   15   51-65     39-53  (83)
 25 PF12588 PSDC:  Phophatidylseri  26.1      91   0.002   28.7   3.8   40   51-90     98-138 (141)
 26 PHA01513 mnt Mnt                24.5 1.2E+02  0.0027   26.0   4.1   41   37-93     22-62  (82)
 27 PF05596 Taeniidae_ag:  Taeniid  24.2      25 0.00055   28.7  -0.0   20  338-357     8-27  (64)
 28 PF14193 DUF4315:  Domain of un  21.7 1.9E+02  0.0041   24.7   4.7   31   19-49     10-40  (83)
 29 PF06931 Adeno_E4_ORF3:  Mastad  21.6      67  0.0014   29.2   2.1   15   51-65     21-35  (113)
 30 KOG2345 Serine/threonine prote  21.3      50  0.0011   34.1   1.4   37  285-321   201-249 (302)
 31 KOG3598 Thyroid hormone recept  21.1 1.3E+02  0.0028   37.5   4.7  156  253-452  1694-1853(2220)
 32 PF14433 SUKH-3:  SUKH-3 immuni  20.9      37 0.00081   29.3   0.4   14  340-353    40-53  (142)
 33 smart00150 SPEC Spectrin repea  20.8   3E+02  0.0064   20.5   5.2   46   15-64     40-88  (101)
 34 COG0373 HemA Glutamyl-tRNA red  20.8      90   0.002   33.1   3.1   45   25-69    293-337 (414)
 35 PF05385 Adeno_E4:  Mastadenovi  20.6      35 0.00076   30.8   0.1    9  303-311    53-61  (109)
 36 PLN03166 60S ribosomal protein  20.1      54  0.0012   28.7   1.2   16  206-223    41-56  (96)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=95.83  E-value=0.00036  Score=58.83  Aligned_cols=100  Identities=25%  Similarity=0.608  Sum_probs=54.7

Q ss_pred             HHHHhhhcCCccC----CcccccccccCCCCCcccccccccccchhhhhhhcccccchhhcccCccccCCCCCCCCchhh
Q 011834          262 AALSARAQGKDVG----IPECEGAATAKSPWNAPELFDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHE  337 (476)
Q Consensus       262 aAL~AK~qGK~VG----IP~CEGAAtaKSPWNApELFDlsvleGEtiREWLFFDKPRRAFeSGnRKQRSLPDY~GRGWHE  337 (476)
                      .-|..|+.|...-    |++|  -.-+..||+-|+.++.    ++  +||+||=+.++....|+|+.|.-.   |=-||.
T Consensus        17 ~yL~~k~~g~~~~~~~~i~~~--Diy~~~P~~L~~~~~~----~~--~~~yFF~~~~~~~~~~~r~~R~~~---~G~Wk~   85 (129)
T PF02365_consen   17 HYLRPKILGEPLPCEDVIHDV--DIYSAHPWELPAKFKG----GD--EEWYFFSPRKKKYPNGGRPNRVTG---GGYWKS   85 (129)
T ss_dssp             CTHHHHHTT-HHCS-CHSEE----GGGS-GGGCHHHSSS-----S--SEEEEEEE----------S-EEET---TEEEEE
T ss_pred             HHHHHHhcCCCCCcccceeec--ccCccChHHhhhhccC----CC--ceEEEEEecccccCCccccccccc---ceEEee
Confidence            4577778776521    4555  5667799998853332    23  399999999999999999999755   444997


Q ss_pred             hHH--HHHH---HhcCcccc--cccCCCC-CCCcceeeeEEee
Q 011834          338 SRK--QVMN---EFGGLKRS--YYMDPQP-LNHFEWHLYEYEI  372 (476)
Q Consensus       338 SRK--QVMk---efGGlKRS--YYMDPQP-~~~~EWHLyEYEI  372 (476)
                      +.+  .|+.   ..-|.||+  ||.-.++ ...-.|-|.||.|
T Consensus        86 ~g~~~~i~~~~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L  128 (129)
T PF02365_consen   86 TGKEKPIKDPGGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSL  128 (129)
T ss_dssp             ECEEEEEEE-TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE
T ss_pred             cccccccccccceeeeeEEEEEEEeccCCCCCcCCeEEEEEEe
Confidence            765  3443   24566664  6743333 3366899999987


No 2  
>cd08780 Death_TRADD Death Domain of Tumor Necrosis Factor Receptor 1-Associated Death Domain protein. Death domain (DD) of TRADD (TNF Receptor 1-Associated Death Domain or TNFRSF1A-associated via death domain) protein. TRADD is a central signaling adaptor for TNF-receptor 1 (TNFR1), mediating activation of Nuclear Factor -kappaB (NF-kB) and c-Jun N-terminal kinase (JNK), as well as caspase-dependent apoptosis. It also carries important immunological roles including germinal center formation, DR3-mediated T-cell stimulation, and TNFalpha-mediated inflammatory responses. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into s
Probab=91.02  E-value=0.15  Score=44.07  Aligned_cols=14  Identities=43%  Similarity=0.510  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHh
Q 011834           51 LEEQVHQMLREWKA   64 (476)
Q Consensus        51 lEeQvhQmLREWka   64 (476)
                      |+|||+||||+|+.
T Consensus        47 L~EqvyQ~L~~W~~   60 (90)
T cd08780          47 LYEQAYQLLRRFIQ   60 (90)
T ss_pred             HHHHHHHHHHHHHH
Confidence            89999999999996


No 3  
>cd08313 Death_TNFR1 Death domain of Tumor Necrosis Factor Receptor 1. Death Domain (DD) found in tumor necrosis factor receptor-1 (TNFR-1). TNFR-1 has many names including TNFRSF1A, CD120a, p55, p60, and TNFR60. It activates two major intracellular signaling pathways that lead to the activation of the transcription factor NF-kB and the induction of cell death. Upon binding of its ligand TNF, TNFR-1 trimerizes which leads to the recruitment of an adaptor protein named TNFR-associated death domain protein (TRADD) through a DD/DD interaction. Mutations in the TNFRSF1A gene causes TNFR-associated periodic syndrome (TRAPS), a rare disorder characterized recurrent fever, myalgia, abdominal pain, conjunctivitis and skin eruptions. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation a
Probab=87.00  E-value=0.43  Score=39.60  Aligned_cols=17  Identities=29%  Similarity=0.407  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHhhc
Q 011834           50 LLEEQVHQMLREWKAEL   66 (476)
Q Consensus        50 vlEeQvhQmLREWkaEL   66 (476)
                      -+.||++||||.|+.--
T Consensus        37 ~~~Eq~yqmL~~W~~~~   53 (80)
T cd08313          37 RCRDAQYQMLKVWKERG   53 (80)
T ss_pred             ChHHHHHHHHHHHHHhc
Confidence            57899999999999653


No 4  
>cd08319 Death_RAIDD Death domain of RIP-associated ICH-1 homologous protein with a death domain. Death domain (DD) of RAIDD (RIP-associated ICH-1 homologous protein with a death domain), also known as CRADD (Caspase and RIP adaptor). RAIDD is an adaptor protein that together with the p53-inducible protein PIDD and caspase-2, forms the PIDDosome complex, which is required for caspase-2 activation and plays a role in mediating stress-induced apoptosis. RAIDD contains an N-terminal Caspase Activation and Recruitment Domain (CARD), which interacts with the caspase-2 CARD, and a C-terminal DD, which interacts with the DD of PIDD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD, DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other pr
Probab=84.65  E-value=0.68  Score=38.53  Aligned_cols=17  Identities=18%  Similarity=0.577  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHhhcC
Q 011834           51 LEEQVHQMLREWKAELH   67 (476)
Q Consensus        51 lEeQvhQmLREWkaEL~   67 (476)
                      ++|||+|||+.||..-.
T Consensus        41 l~eQv~~mL~~W~~r~G   57 (83)
T cd08319          41 VQSQIVEALVKWRQRFG   57 (83)
T ss_pred             HHHHHHHHHHHHHHhcC
Confidence            79999999999998644


No 5  
>cd08777 Death_RIP1 Death Domain of Receptor-Interacting Protein 1. Death domain (DD) found in Receptor-Interacting Protein 1 (RIP1) and related proteins. RIP kinases serve as essential sensors of cellular stress. Vertebrates contain several types containing a homologous N-terminal kinase domain and varying C-terminal domains. RIP1 harbors a C-terminal DD, which binds death receptors (DRs) including TNF receptor 1, Fas, TNF-related apoptosis-inducing ligand receptor 1 (TRAILR1), and TRAILR2. It also interacts with other DD-containing adaptor proteins such as TRADD and FADD. RIP1 plays a crucial role in determining a cell's fate, between survival or death, following exposure to stress signals. It is important in the signaling of NF-kappaB and MAPKs, and it links DR-associated signaling to reactive oxygen species (ROS) production. Abnormal RIP1 function may result in ROS accumulation affecting inflammatory responses, innate immunity, stress responses, and cell survival. In general, DDs ar
Probab=77.39  E-value=1.8  Score=35.92  Aligned_cols=15  Identities=60%  Similarity=1.119  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHhh
Q 011834           51 LEEQVHQMLREWKAE   65 (476)
Q Consensus        51 lEeQvhQmLREWkaE   65 (476)
                      ++||++|||+.|+..
T Consensus        42 ~~eq~~~mL~~W~~r   56 (86)
T cd08777          42 LKEKVHQMLHKWKMK   56 (86)
T ss_pred             HHHHHHHHHHHHHHc
Confidence            689999999999974


No 6  
>cd08316 Death_FAS_TNFRSF6 Death domain of FAS or TNF receptor superfamily member 6. Death Domain (DD) found in the FS7-associated cell surface antigen (FAS). FAS, also known as TNFRSF6 (TNF receptor superfamily member 6), APT1, CD95, FAS1, or APO-1, together with FADD (Fas-associating via Death Domain) and caspase 8, is an integral part of the death inducing signalling complex (DISC), which plays an important role in the induction of apoptosis and is activated by binding of the ligand FasL to FAS. FAS also plays a critical role in self-tolerance by eliminating cell types (autoreactive T and B cells) that contribute to autoimmunity. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in sign
Probab=75.08  E-value=2.1  Score=36.68  Aligned_cols=15  Identities=40%  Similarity=0.614  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHhh
Q 011834           51 LEEQVHQMLREWKAE   65 (476)
Q Consensus        51 lEeQvhQmLREWkaE   65 (476)
                      +.||++||||.|+.-
T Consensus        48 ~~Eq~~qmL~~W~~~   62 (97)
T cd08316          48 TAEQKVQLLRAWYQS   62 (97)
T ss_pred             hHHHHHHHHHHHHHH
Confidence            489999999999965


No 7  
>cd08784 Death_DRs Death Domain of Death Receptors. Death domain (DD) found in death receptor proteins. Death receptors are members of the tumor necrosis factor (TNF) receptor superfamily, characterized by having a cytoplasmic DD. Known members of the family are Fas (CD95/APO-1), TNF-receptor 1 (TNFR1/TNFRSF1A/p55/CD120a), TNF-related apoptosis-inducing ligand receptor 1 (TRAIL-R1 /DR4), and receptor 2 (TRAIL-R2/DR5/APO-2/KILLER), as well as Death Receptor 3 (DR3/APO-3/TRAMP/WSL-1/LARD). They are involved in apoptosis signaling pathways. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=72.82  E-value=3.7  Score=33.20  Aligned_cols=30  Identities=20%  Similarity=0.385  Sum_probs=21.2

Q ss_pred             hhhhHHHhhhccccchHHHHHHHHHHHHHHHhh
Q 011834           33 FLDLQFARKESRTVDVSLLEEQVHQMLREWKAE   65 (476)
Q Consensus        33 F~~LQ~ARKEsR~~D~avlEeQvhQmLREWkaE   65 (476)
                      |++-+--+-|..+.|   +.||++|||+.|+.-
T Consensus        23 ls~~~I~~ie~~~~~---~~eq~~~mL~~W~~k   52 (79)
T cd08784          23 LSDNEIKVAELDNPQ---HRDRVYELLRIWRNK   52 (79)
T ss_pred             CCHHHHHHHHHcCCc---hHHHHHHHHHHHHhc
Confidence            344444445566666   689999999999964


No 8  
>cd08779 Death_PIDD Death Domain of p53-induced protein with a death domain. Death domain (DD) found in PIDD (p53-induced protein with a death domain) and similar proteins. PIDD is a component of the PIDDosome complex, which is an oligomeric caspase-activating complex involved in caspase-2 activation and plays a role in mediating stress-induced apoptosis. The PIDDosome complex is composed of three components, PIDD, RAIDD and caspase-2, which interact through their DDs and DD-like domains. The DD of PIDD interacts with the DD of RAIDD, which also contains a Caspase Activation and Recruitment Domain (CARD) that interacts with the caspase-2 CARD. Autoproteolysis of PIDD determines the downstream signaling event, between pro-survival NF-kB or pro-death caspase-2 activation. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members 
Probab=72.32  E-value=2.8  Score=34.55  Aligned_cols=16  Identities=38%  Similarity=0.721  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHhhc
Q 011834           51 LEEQVHQMLREWKAEL   66 (476)
Q Consensus        51 lEeQvhQmLREWkaEL   66 (476)
                      |.+|+++||+.|+..-
T Consensus        41 l~eq~~~mL~~W~~~~   56 (86)
T cd08779          41 LDEQIFDMLFSWAQRQ   56 (86)
T ss_pred             HHHHHHHHHHHHHHhc
Confidence            5899999999998754


No 9  
>cd08318 Death_NMPP84 Death domain of Nuclear Matrix Protein P84. Death domain (DD) found in the Nuclear Matrix Protein P84 (also known as HPR1 or THOC1). HPR1/p84 resides in the nuclear matrix and is part of the THO complex, also called TREX (transcription/export) complex, which functions in mRNP biogenesis at the interface between transcription and export of mRNA from the nucleus. Mice lacking THOC1 have abnormal testis development and are sterile. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=68.05  E-value=5.9  Score=32.53  Aligned_cols=29  Identities=21%  Similarity=0.424  Sum_probs=20.3

Q ss_pred             hhhHHHhhhccccchHHHHHHHHHHHHHHHhhcC
Q 011834           34 LDLQFARKESRTVDVSLLEEQVHQMLREWKAELH   67 (476)
Q Consensus        34 ~~LQ~ARKEsR~~D~avlEeQvhQmLREWkaEL~   67 (476)
                      .+++..+.+.+  |   +.+|++|||+.|+..-.
T Consensus        33 ~dI~~i~~~~~--~---~~eq~~~mL~~W~~r~g   61 (86)
T cd08318          33 KEIRAIESDSE--D---IKMQAKQLLVAWQDREG   61 (86)
T ss_pred             HHHHHHHhcCC--C---HHHHHHHHHHHHHHhcC
Confidence            34455555543  5   58999999999997543


No 10 
>cd08804 Death_ank2 Death domain of Ankyrin-2. Death Domain (DD) of Ankyrin-2 (ANK-2) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-2, also called ankyrin-B (for broadly expressed), is required for proper function of the Na/Ca ion exchanger-1 in cardiomyocytes, and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. Human ANK-2 is associated with "Ankyrin-B syndrome", an atypical arrythmia disorder with risk of sudden cardiac death. It also plays key roles in the brain and striated muscle. Loss of ANK-2 is associated with significant nervous system defects and sarcomere disorganization. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other
Probab=64.62  E-value=5.2  Score=32.95  Aligned_cols=15  Identities=33%  Similarity=0.782  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHhh
Q 011834           51 LEEQVHQMLREWKAE   65 (476)
Q Consensus        51 lEeQvhQmLREWkaE   65 (476)
                      +.+|+++||+.|+..
T Consensus        43 ~~eq~~~mL~~W~~r   57 (84)
T cd08804          43 LQDQSHALLKYWLER   57 (84)
T ss_pred             HHHHHHHHHHHHHHc
Confidence            589999999999975


No 11 
>cd08306 Death_FADD Fas-associated Death Domain protein-protein interaction domain. Death domain (DD) found in FAS-associated via death domain (FADD). FADD is a component of the death-inducing signaling complex (DISC) and serves as an adaptor in the signaling pathway of death receptor proteins. It modulates apoptosis as well as non-apoptotic processes such as cell cycle progression, survival, innate immune signaling, and hematopoiesis. FADD contains an N-terminal DED and a C-terminal DD. Its DD interacts with the DD of the activated death receptor, FAS, and its DED recruits the initiator caspases, caspase-8 and -10, to the DISC complex via a homotypic interaction with the N-terminal DED of the caspase. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain),
Probab=64.03  E-value=5.3  Score=32.88  Aligned_cols=15  Identities=67%  Similarity=0.946  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHhh
Q 011834           51 LEEQVHQMLREWKAE   65 (476)
Q Consensus        51 lEeQvhQmLREWkaE   65 (476)
                      +.||++|||+.|+..
T Consensus        41 ~~eq~~~mL~~W~~~   55 (86)
T cd08306          41 LREQVRQSLREWKKI   55 (86)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            579999999999974


No 12 
>cd08315 Death_TRAILR_DR4_DR5 Death domain of Tumor necrosis factor-Related Apoptosis-Inducing Ligand Receptors. Death Domain (DD) found in Tumor necrosis factor-Related Apoptosis-Inducing Ligand (TRAIL) Receptors. In mammals, this family includes TRAILR1 (also called DR4 or TNFRSF10A) and TRAILR2 (also called DR5, TNFRSF10B, or KILLER). They function as receptors for the cytokine TRAIL and are involved in apoptosis signaling pathways. TRAIL preferentially induces apoptosis in cancer cells while exhibiting little toxicity in normal cells. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=63.47  E-value=5  Score=33.93  Aligned_cols=15  Identities=40%  Similarity=0.603  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHhhc
Q 011834           52 EEQVHQMLREWKAEL   66 (476)
Q Consensus        52 EeQvhQmLREWkaEL   66 (476)
                      .||++|||+.|+.--
T Consensus        47 ~eq~~qmL~~W~~~~   61 (96)
T cd08315          47 REQLYQMLLTWVNKT   61 (96)
T ss_pred             HHHHHHHHHHHHHhh
Confidence            799999999999653


No 13 
>cd08317 Death_ank Death domain associated with Ankyrins. Death Domain (DD) associated with Ankyrins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. Ankyrins function as adaptor proteins and they interact, through ANK repeats, with structurally diverse membrane proteins, including ion channels/pumps, calcium release channels, and cell adhesion molecules. They play critical roles in the proper expression and membrane localization of these proteins. In mammals, this family includes ankyrin-R for restricted (or ANK1), ankyrin-B for broadly expressed (or ANK2) and ankyrin-G for general or giant (or ANK3). They are expressed in different combinations in many tissues and play non-overlapping functions. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-associati
Probab=48.19  E-value=15  Score=29.66  Aligned_cols=14  Identities=29%  Similarity=0.624  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHhh
Q 011834           52 EEQVHQMLREWKAE   65 (476)
Q Consensus        52 EeQvhQmLREWkaE   65 (476)
                      .||++|||+.|+..
T Consensus        44 ~eq~~~mL~~W~~r   57 (84)
T cd08317          44 AQQAQAMLKLWLER   57 (84)
T ss_pred             HHHHHHHHHHHHHh
Confidence            49999999999986


No 14 
>smart00005 DEATH DEATH domain, found in proteins involved in cell death (apoptosis). Alpha-helical domain present in a variety of proteins with apoptotic functions. Some (but not all) of these domains form homotypic and heterotypic dimers.
Probab=41.54  E-value=22  Score=27.78  Aligned_cols=15  Identities=47%  Similarity=0.762  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHhh
Q 011834           51 LEEQVHQMLREWKAE   65 (476)
Q Consensus        51 lEeQvhQmLREWkaE   65 (476)
                      +.+|+.|||++|+..
T Consensus        45 ~~~~~~~lL~~W~~~   59 (88)
T smart00005       45 LAEQSVQLLRLWEQR   59 (88)
T ss_pred             HHHHHHHHHHHHHHc
Confidence            478999999999875


No 15 
>cd08805 Death_ank1 Death domain of Ankyrin-1. Death Domain (DD) of the human protein ankyrin-1 (ANK-1) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-1, also called ankyrin-R (for restricted), is found in brain, muscle, and erythrocytes and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. It plays a critical nonredundant role in erythroid development and is associated with hereditary spherocytosis (HS), a common disorder of the red cell membrane. The small alternatively-spliced variant, sANK-1, found in striated muscle and concentrated in the sarcoplasmic reticulum (SR) binds obscurin and titin, which facilitates the anchoring of the network SR to the contractile apparatus. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common featur
Probab=38.80  E-value=25  Score=29.52  Aligned_cols=15  Identities=33%  Similarity=0.510  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHhh
Q 011834           51 LEEQVHQMLREWKAE   65 (476)
Q Consensus        51 lEeQvhQmLREWkaE   65 (476)
                      +.+|+++||+.|+..
T Consensus        43 l~~Q~~~~L~~W~~r   57 (84)
T cd08805          43 LLEQSTALLNLWVDR   57 (84)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            679999999999975


No 16 
>cd08815 Death_TNFRSF25_DR3 Death domain of Tumor Necrosis Factor Receptor superfamily 25. Death Domain (DD) found in Tumor Necrosis Factor (TNF) receptor superfamily 25 (TNFRSF25), also known as TRAMP (TNF receptor-related apoptosis-mediating protein), LARD, APO-3, WSL-1, or DR3 (Death Receptor-3). TNFRSF25 is primarily expressed in T cells, is activated by binding to its ligand TL1A, and plays an important role in T-cell function. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=38.44  E-value=19  Score=30.48  Aligned_cols=20  Identities=20%  Similarity=0.634  Sum_probs=16.2

Q ss_pred             chHHHHHHHHHHHHHHHhhc
Q 011834           47 DVSLLEEQVHQMLREWKAEL   66 (476)
Q Consensus        47 D~avlEeQvhQmLREWkaEL   66 (476)
                      |..-.+||+||||+-|+..-
T Consensus        34 ~~~~~rda~y~ML~~W~~q~   53 (77)
T cd08815          34 EIGRFRDQQYEMLKRWRQQQ   53 (77)
T ss_pred             cccchHHHHHHHHHHHHHcC
Confidence            33567899999999999764


No 17 
>COG0113 HemB Delta-aminolevulinic acid dehydratase [Coenzyme metabolism]
Probab=35.28  E-value=16  Score=37.99  Aligned_cols=13  Identities=46%  Similarity=1.134  Sum_probs=11.3

Q ss_pred             HhcCcccccccCCC
Q 011834          345 EFGGLKRSYYMDPQ  358 (476)
Q Consensus       345 efGGlKRSYYMDPQ  358 (476)
                      .||+ ||||+|||-
T Consensus       218 ~~gd-rktYQmDpa  230 (330)
T COG0113         218 KFGD-RKTYQMDPA  230 (330)
T ss_pred             ccCC-cceeccCCc
Confidence            5788 999999985


No 18 
>cd01670 Death Death Domain: a protein-protein interaction domain. Death Domains (DDs) are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. Structural analysis of DD-DD complexes show that the domains interact with each other in many different ways. DD-containing proteins serve as adaptors in signaling pathways and they can recruit other proteins into signaling complexes. In mammals, they are prominent components of the programmed cell death (apoptosis) pathway and are found in a number of other signaling pathways. In invertebrates, they are involved in transcriptional regulation of zygotic patterning genes in insect embryogenesis, and are components of the ToII/NF-kappaB pathway, a conserved innate immune pathway in a
Probab=32.67  E-value=50  Score=25.15  Aligned_cols=17  Identities=29%  Similarity=0.520  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHhhcC
Q 011834           51 LEEQVHQMLREWKAELH   67 (476)
Q Consensus        51 lEeQvhQmLREWkaEL~   67 (476)
                      +.+|.++||+.|+..-.
T Consensus        37 ~~~~~~~mL~~W~~~~~   53 (79)
T cd01670          37 VREQAYQLLLKWEEREG   53 (79)
T ss_pred             HHHHHHHHHHHHHhccC
Confidence            68999999999987643


No 19 
>PF11464 Rbsn:  Rabenosyn Rab binding domain;  InterPro: IPR021565  Rabenosyn-5 (Rbsn) is a multivalent effector with interacts with the Rab family.Rsbn contains distinct Rab4 and Rab5 binding sites within residues 264-500 and 627-784 respectively []. Rab proteins are GTPases involved in the regulation of all stages of membrane trafficking []. ; PDB: 1Z0K_B 1YZM_A 1Z0J_B.
Probab=30.78  E-value=62  Score=24.88  Aligned_cols=28  Identities=25%  Similarity=0.326  Sum_probs=21.4

Q ss_pred             hhhHHHhhhccccchHHHHHHHHHHHHH
Q 011834           34 LDLQFARKESRTVDVSLLEEQVHQMLRE   61 (476)
Q Consensus        34 ~~LQ~ARKEsR~~D~avlEeQvhQmLRE   61 (476)
                      +-++.||+.+|--+|+.||+-+++.=+|
T Consensus        10 ~~I~qAk~~~r~dEV~~L~~NL~EL~~e   37 (42)
T PF11464_consen   10 SYIKQAKAARRFDEVATLEENLRELQDE   37 (42)
T ss_dssp             HHHHHHHHTT-HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhcCcHHHHHHHHHHHHHHHH
Confidence            3478899999999999999876655444


No 20 
>cd08311 Death_p75NR Death domain of p75 Neurotophin Receptor. Death Domain (DD) found in p75 neurotrophin receptor (p75NTR, NGFR, TNFRSF16). p75NTR binds members of the neurotrophin (NT) family including nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), and NT3, among others. It contains an NT-binding extracellular region that bears four cysteine-rich repeats, a transmembrane domain, and an intracellular DD. p75NTR plays roles in the immune, vascular, and nervous systems, and has been shown to promote cell death or survival, and to induce neurite outgrowth or collapse depending on its ligands and co-receptors. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptor
Probab=30.66  E-value=34  Score=28.20  Aligned_cols=13  Identities=31%  Similarity=0.803  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHhh
Q 011834           53 EQVHQMLREWKAE   65 (476)
Q Consensus        53 eQvhQmLREWkaE   65 (476)
                      +|+++||++|+..
T Consensus        40 ~p~~~lL~~W~~r   52 (77)
T cd08311          40 SPVRTLLADWSAQ   52 (77)
T ss_pred             hHHHHHHHHHHHC
Confidence            8999999999973


No 21 
>cd08803 Death_ank3 Death domain of Ankyrin-3. Death Domain (DD) of the human protein ankyrin-3 (ANK-3) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-3, also called anykyrin-G (for general or giant), is found in neurons and at least one splice variant has been shown to be essential for propagation of action potentials as a binding partner to neurofascin and voltage-gated sodium channels. It is required for maintaining axo-dendritic polarity, and may be a genetic risk factor associated with bipolar disorder. ANK-3 may also play roles in other cell types. Mutations affecting ANK-3 pathways for Na channel localization are associated with Brugada syndrome, a potentially fata arrythmia. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by se
Probab=30.53  E-value=41  Score=28.10  Aligned_cols=29  Identities=21%  Similarity=0.298  Sum_probs=19.8

Q ss_pred             hhhHHHhhhccccchHHHHHHHHHHHHHHHhhc
Q 011834           34 LDLQFARKESRTVDVSLLEEQVHQMLREWKAEL   66 (476)
Q Consensus        34 ~~LQ~ARKEsR~~D~avlEeQvhQmLREWkaEL   66 (476)
                      .++..-+.|.. .|   +.+|+++||+.|+..=
T Consensus        30 ~dI~~i~~e~p-~~---~~~q~~~lL~~W~~r~   58 (84)
T cd08803          30 DEINQIRVENP-NS---LIAQSFMLLKKWVTRD   58 (84)
T ss_pred             HHHHHHHHhCC-CC---HHHHHHHHHHHHHHhh
Confidence            34444455544 33   6799999999999853


No 22 
>TIGR02132 phaR_Bmeg polyhydroxyalkanoic acid synthase, PhaR subunit. This model describes a protein, PhaR, localized to polyhydroxyalkanoic acid (PHA) inclusion granules in Bacillus cereus and related species. PhaR is required for PHA biosynthesis along with PhaC and may be a regulatory subunit.
Probab=29.23  E-value=74  Score=31.08  Aligned_cols=41  Identities=20%  Similarity=0.247  Sum_probs=29.5

Q ss_pred             HhhhhhhhhHHhhhhhHHHhh---hccc----------cchHHHHHHHHHHHHH
Q 011834           21 KAKTRVDDLQGKFLDLQFARK---ESRT----------VDVSLLEEQVHQMLRE   61 (476)
Q Consensus        21 ~ak~rvddLQ~~F~~LQ~ARK---EsR~----------~D~avlEeQvhQmLRE   61 (476)
                      +..+|||+|++.|.++=-++.   |.+.          .|+.-||+-|.|||+-
T Consensus        83 nlE~kvD~lee~fdd~~d~l~~q~eq~~~~~~~v~~~~q~~~~l~~K~D~~L~l  136 (189)
T TIGR02132        83 NLEEKVDLIEEFFDDKFDELEAQQEQAPALKKDVTKLKQDIKSLDKKLDKILEL  136 (189)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhCchHHhHHHHHHHHHHHHHHHHHHHHHH
Confidence            457899999999988533332   3332          3778888999999874


No 23 
>PF02840 Prp18:  Prp18 domain;  InterPro: IPR004098 The splicing factor Prp18 is required for the second step of pre-mRNA splicing. PRP18 appears to be primarily associated with the U5 snRNP. The structure of a large fragment of the Saccharomyces cerevisiae Prp18 is known []. This fragment is fully active in yeast splicing in vitro and includes the sequences of Prp18 that have been evolutionarily conserved. The core structure consists of five alpha-helices that adopt a novel fold. The most highly conserved region of Prp18, a nearly invariant stretch of 19 aa, forms part of a loop between two alpha-helices and may interact with the U5 small nuclear ribonucleoprotein particles [].; GO: 0008380 RNA splicing, 0005681 spliceosomal complex; PDB: 1DVK_A.
Probab=26.92  E-value=56  Score=30.28  Aligned_cols=40  Identities=20%  Similarity=0.390  Sum_probs=24.2

Q ss_pred             HHHHHHHHHhhcCCCCCC--cccccCCCCc--cc---hhHHHHhhhhc
Q 011834           55 VHQMLREWKAELHEPSPA--SSLQQDGSLG--FS---SDIYRLLQLCE   95 (476)
Q Consensus        55 vhQmLREWkaEL~~pSPA--sSLq~g~s~g--fs---sd~~rLLQl~e   95 (476)
                      ++.+|+||..+|+..+.+  .|.| |....  +.   .++..|+.+++
T Consensus         5 ~k~lL~eW~~~l~~r~~~~k~s~~-gk~~~~~~~qtk~~l~PL~~~Lk   51 (144)
T PF02840_consen    5 IKFLLKEWEEELNSRPEEEKRSAQ-GKQASATYKQTKRYLKPLFKKLK   51 (144)
T ss_dssp             HHHHHHHHHHCCCCS-CC-------------CHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCChhhhhhhh-hhhhHHHHHHHHHHHHHHHHHHH
Confidence            678999999999998887  4442 22211  22   67777888774


No 24 
>PF00531 Death:  Death domain;  InterPro: IPR000488 The death domain (DD) is a homotypic protein interaction module composed of a bundle of six alpha-helices. DD is related in sequence and structure to the death effector domain (DED, see IPR001875 from INTERPRO) and the caspase recruitment domain (CARD, see IPR001315 from INTERPRO), which work in similar pathways and show similar interaction properties []. DD bind each other forming oligomers. Mammals have numerous and diverse DD-containing proteins []. Within these proteins, the DD domains can be found in combination with other domains, including: CARDs, DEDs, ankyrin repeats (IPR002110 from INTERPRO), caspase-like folds, kinase domains, leucine zippers (IPR002158 from INTERPRO), leucine-rich repeats (LRR) (IPR001611 from INTERPRO), TIR domains (IPR000157 from INTERPRO), and ZU5 domains (IPR000906 from INTERPRO) []. Some DD-containing proteins are involved in the regulation of apoptosis and inflammation through their activation of caspases and NF-kappaB, which typically involves interactions with TNF (tumour necrosis factor) cytokine receptors [, ]. In humans, eight of the over 30 known TNF receptors contain DD in their cytoplasmic tails; several of these TNF receptors use caspase activation as a signalling mechanism. The DD mediates self-association of these receptors, thus giving the signal to downstream events that lead to apoptosis. Other DD-containing proteins, such as ankyrin, MyD88 and pelle, are probably not directly involved in cell death signalling. DD-containing proteins also have links to innate immunity, communicating with Toll family receptors through bipartite adapter proteins such as MyD88 [].; GO: 0005515 protein binding, 0007165 signal transduction; PDB: 3OQ9_L 3EZQ_F 1E41_A 1E3Y_A 2GF5_A 2OF5_L 3EWV_E 3G5B_A 3MOP_L 2A9I_A ....
Probab=26.15  E-value=56  Score=24.84  Aligned_cols=15  Identities=40%  Similarity=0.833  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHhh
Q 011834           51 LEEQVHQMLREWKAE   65 (476)
Q Consensus        51 lEeQvhQmLREWkaE   65 (476)
                      ..+|.++||+.|+..
T Consensus        39 ~~~~~~~~L~~W~~~   53 (83)
T PF00531_consen   39 LREQTYEMLQRWRQR   53 (83)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHh
Confidence            679999999999988


No 25 
>PF12588 PSDC:  Phophatidylserine decarboxylase ;  InterPro: IPR022237  This domain family is found in bacteria and eukaryotes, and is approximately 140 amino acids in length. The family is found in association with PF02666 from PFAM. Phosphatidylserine decarboxylase (PSD) is an important enzyme in the synthesis of phosphatidylethanolamine in both prokaryotes and eukaryotes. 
Probab=26.08  E-value=91  Score=28.70  Aligned_cols=40  Identities=30%  Similarity=0.549  Sum_probs=28.5

Q ss_pred             HHHHHHHHHHHHHhhcCCCCCCcccccCCCCc-cchhHHHH
Q 011834           51 LEEQVHQMLREWKAELHEPSPASSLQQDGSLG-FSSDIYRL   90 (476)
Q Consensus        51 lEeQvhQmLREWkaEL~~pSPAsSLq~g~s~g-fssd~~rL   90 (476)
                      +-+|+..+|.+|.+=|.-|.-++.|-.+..-| ||.+-..-
T Consensus        98 vN~~lK~ILn~W~~fL~sp~S~~vL~~~~~~GWfs~~A~~~  138 (141)
T PF12588_consen   98 VNAQLKKILNEWGEFLSSPASRSVLNTDPPNGWFSPEALKE  138 (141)
T ss_pred             HHHHHHHHHHHHHHHcCChhhhccccCCCCCCccCHHHHHH
Confidence            35788888999999999666666673332458 88776543


No 26 
>PHA01513 mnt Mnt
Probab=24.50  E-value=1.2e+02  Score=26.05  Aligned_cols=41  Identities=27%  Similarity=0.448  Sum_probs=29.2

Q ss_pred             HHHhhhccccchHHHHHHHHHHHHHHHhhcCCCCCCcccccCCCCccchhHHHHhhh
Q 011834           37 QFARKESRTVDVSLLEEQVHQMLREWKAELHEPSPASSLQQDGSLGFSSDIYRLLQL   93 (476)
Q Consensus        37 Q~ARKEsR~~D~avlEeQvhQmLREWkaEL~~pSPAsSLq~g~s~gfssd~~rLLQl   93 (476)
                      +.|.+|+||.     .++|-+.|..|   |..|||.+-+        -.|..|+-+.
T Consensus        22 ~aA~~nGRSm-----NaeIv~~Le~a---l~~~~~~~g~--------~~~~~~~a~~   62 (82)
T PHA01513         22 QRAKANGRSL-----NAELVQIVQDA---LSKPSPVTGY--------RDDAERLADE   62 (82)
T ss_pred             HHHHHhCCCH-----HHHHHHHHHHH---hcCCCcchhh--------HHHHHHHHHH
Confidence            4689999995     56777888877   6678887655        4566666543


No 27 
>PF05596 Taeniidae_ag:  Taeniidae antigen;  InterPro: IPR008860 This family consists of several antigen proteins from Taenia and Echinococcus (tapeworm) species.
Probab=24.19  E-value=25  Score=28.74  Aligned_cols=20  Identities=25%  Similarity=0.496  Sum_probs=18.3

Q ss_pred             hHHHHHHHhcCcccccccCC
Q 011834          338 SRKQVMNEFGGLKRSYYMDP  357 (476)
Q Consensus       338 SRKQVMkefGGlKRSYYMDP  357 (476)
                      -+|.|||..|=.++.||.||
T Consensus         8 ~~k~~kK~i~~v~~FF~~DP   27 (64)
T PF05596_consen    8 DKKSVKKWIEEVRNFFYEDP   27 (64)
T ss_pred             hHHhHHHHHHHHHHHhccCc
Confidence            36889999999999999998


No 28 
>PF14193 DUF4315:  Domain of unknown function (DUF4315)
Probab=21.69  E-value=1.9e+02  Score=24.68  Aligned_cols=31  Identities=19%  Similarity=0.500  Sum_probs=26.8

Q ss_pred             HHHhhhhhhhhHHhhhhhHHHhhhccccchH
Q 011834           19 KDKAKTRVDDLQGKFLDLQFARKESRTVDVS   49 (476)
Q Consensus        19 ~d~ak~rvddLQ~~F~~LQ~ARKEsR~~D~a   49 (476)
                      .+|+|.++.++|..+-.|....+|.-+.+++
T Consensus        10 ieK~k~Kiae~Q~rlK~Le~qk~E~EN~EIv   40 (83)
T PF14193_consen   10 IEKTKEKIAELQARLKELEAQKTEAENLEIV   40 (83)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4688899999999999999999998776654


No 29 
>PF06931 Adeno_E4_ORF3:  Mastadenovirus E4 ORF3 protein;  InterPro: IPR009699 This family consists of several Mastadenovirus E4 ORF3 proteins. Early proteins E4 ORF3 and E4 ORF6 have complementary functions during viral infection. Both proteins facilitate efficient viral DNA replication, late protein expression, and prevention of concatenation of viral genomes. A unique function of E4 ORF3 is the reorganisation of nuclear structures known as PML oncogenic domains (PODs). The function of these domains is unclear, but PODs have been implicated in a number of important cellular processes, including transcriptional regulation, apoptosis, transformation, and response to interferon [].
Probab=21.58  E-value=67  Score=29.24  Aligned_cols=15  Identities=47%  Similarity=0.982  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHhh
Q 011834           51 LEEQVHQMLREWKAE   65 (476)
Q Consensus        51 lEeQvhQmLREWkaE   65 (476)
                      |.+++-|.+|+||+|
T Consensus        21 l~~~~~~Ii~~Wk~E   35 (113)
T PF06931_consen   21 LQQQLTQIIRGWKNE   35 (113)
T ss_pred             HHHHHHHHHHHHhhc
Confidence            567889999999987


No 30 
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]
Probab=21.32  E-value=50  Score=34.06  Aligned_cols=37  Identities=32%  Similarity=0.653  Sum_probs=29.5

Q ss_pred             CCCCCccccccccccc-----------chhhhhhhccccc-chhhcccC
Q 011834          285 KSPWNAPELFDLSVLE-----------GETIREWLFFDKP-RRAFESGN  321 (476)
Q Consensus       285 KSPWNApELFDlsvle-----------GEtiREWLFFDKP-RRAFeSGn  321 (476)
                      --|+-|||||++....           |=|+-+-+|+.-| -|+|++|.
T Consensus       201 t~pyRAPELf~vk~~~ti~ertDIWSLGCtLYa~mf~~sPfe~~~~~Gg  249 (302)
T KOG2345|consen  201 TIPYRAPELFNVKSHCTITERTDIWSLGCTLYAMMFGESPFERIYQQGG  249 (302)
T ss_pred             CCcccCchheecccCcccccccchhhhhHHHHHHHHcCCcchHHhhcCC
Confidence            4599999999986542           6677788999998 58888885


No 31 
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]
Probab=21.06  E-value=1.3e+02  Score=37.47  Aligned_cols=156  Identities=28%  Similarity=0.350  Sum_probs=89.8

Q ss_pred             CCCCchhh--HHHHHhhhcCCccCCcccccccccCCCCCcccccccccccchhhhhhhcccccc--hhhcccCccccCCC
Q 011834          253 IGLKDGLL--FAALSARAQGKDVGIPECEGAATAKSPWNAPELFDLSVLEGETIREWLFFDKPR--RAFESGNRKQRSLP  328 (476)
Q Consensus       253 I~LKDg~L--FaAL~AK~qGK~VGIP~CEGAAtaKSPWNApELFDlsvleGEtiREWLFFDKPR--RAFeSGnRKQRSLP  328 (476)
                      ||.|.+-.  |++.- |.+|+-|-.|+      -|||||+=|--+-.+     ---|=||-.-|  |---.+.--+|+|=
T Consensus      1694 idtkgnkiagFdsi~-kK~Glqvstkq------k~spwdlFEg~k~~a-----plsW~wFgTvRvDrrv~~~eeq~rlll 1761 (2220)
T KOG3598|consen 1694 IDTKGNKIAGFDSIE-KKNGLQVSTKQ------KKSPWDLFEGTKHLA-----PLSWKWFGTVRVDRRVKNVEEQLRLLL 1761 (2220)
T ss_pred             cccccceeccchhhh-hhcCceecccc------ccCcchhhccCCCCC-----CccceeeeeeehhHHHHhHHHHHHHHH
Confidence            67776654  88887 99999999987      689999876655442     22488887665  22233333444431


Q ss_pred             CCCCCchhhhHHHHHHHhcCcccccccCCCCCCCcceeeeEEeecccccceeeeeeeeeccCccCcCcccccchHHHHHH
Q 011834          329 DYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYRLELKLVDGKKSAKGKLANDSVADLQK  408 (476)
Q Consensus       329 DY~GRGWHESRKQVMkefGGlKRSYYMDPQP~~~~EWHLyEYEIn~cdacALYRLElK~vD~KKs~K~K~~~~sladlQk  408 (476)
                      -      |   --||    ---|+||..|+|+-.-+    |=|--+       -+|-|-.-.|+-. +|-       +--
T Consensus      1762 y------H---TH~~----p~pR~yyL~PlPlPped----EEe~~~-------~~~e~e~~~~e~~-s~~-------~~d 1809 (2220)
T KOG3598|consen 1762 Y------H---THVL----PFPRDYYLAPLPLPPED----EEEAKK-------AEEEKEAAEKEEE-SKN-------AED 1809 (2220)
T ss_pred             h------h---cccc----CCcchhhccCCCCCccc----ccCCCc-------cCccccccccCcc-ccC-------ccc
Confidence            0      0   0011    12689999999987654    111111       2333333322222 221       111


Q ss_pred             HhccccccccCCCcccccccccccccccccccccccCcccccCC
Q 011834          409 QMGRLTAEFPSDNKRLVKGRAKVNAKAGVGGNIYPASNVVASTN  452 (476)
Q Consensus       409 qMgrLsA~~p~dnkr~~kgrtk~~~k~~~~gn~y~~~n~~~~~n  452 (476)
                      +--.-||+---|.++..||+.+...+++-.-|+|-++-....+.
T Consensus      1810 ~~~~~t~E~KK~~~~g~K~ks~~~~~e~~~~~~~r~~p~~~~~s 1853 (2220)
T KOG3598|consen 1810 EKNKNTAENKKDTKEGEKGKSKDKEKEGEKEKCKRASPKDDVTS 1853 (2220)
T ss_pred             cCCCCchhhhccccccccCCCccccccccccCcccCCCCCCCCC
Confidence            22233455455667778888888888888777887665444443


No 32 
>PF14433 SUKH-3:  SUKH-3 immunity protein
Probab=20.91  E-value=37  Score=29.33  Aligned_cols=14  Identities=36%  Similarity=0.679  Sum_probs=10.7

Q ss_pred             HHHHHHhcCccccc
Q 011834          340 KQVMNEFGGLKRSY  353 (476)
Q Consensus       340 KQVMkefGGlKRSY  353 (476)
                      ++.+.+||||+=.+
T Consensus        40 ~~fL~efGgL~i~~   53 (142)
T PF14433_consen   40 VEFLAEFGGLRINP   53 (142)
T ss_pred             HHHHHHcCCeEEec
Confidence            45899999997543


No 33 
>smart00150 SPEC Spectrin repeats.
Probab=20.83  E-value=3e+02  Score=20.50  Aligned_cols=46  Identities=20%  Similarity=0.320  Sum_probs=28.5

Q ss_pred             hHHHHHHh---hhhhhhhHHhhhhhHHHhhhccccchHHHHHHHHHHHHHHHh
Q 011834           15 HKLFKDKA---KTRVDDLQGKFLDLQFARKESRTVDVSLLEEQVHQMLREWKA   64 (476)
Q Consensus        15 h~~f~d~a---k~rvddLQ~~F~~LQ~ARKEsR~~D~avlEeQvhQmLREWka   64 (476)
                      |+.|+...   +.+|+.+..+-..|-..    ...++..+++.+..+-..|..
T Consensus        40 ~~~~~~e~~~~~~~v~~~~~~~~~L~~~----~~~~~~~i~~~~~~l~~~w~~   88 (101)
T smart00150       40 HEALEAELEAHEERVEALNELGEQLIEE----GHPDAEEIEERLEELNERWEE   88 (101)
T ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHHHHc----CCCcHHHHHHHHHHHHHHHHH
Confidence            55555544   34445554444444332    467888899988888888874


No 34 
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]
Probab=20.82  E-value=90  Score=33.12  Aligned_cols=45  Identities=24%  Similarity=0.267  Sum_probs=38.5

Q ss_pred             hhhhhHHhhhhhHHHhhhccccchHHHHHHHHHHHHHHHhhcCCC
Q 011834           25 RVDDLQGKFLDLQFARKESRTVDVSLLEEQVHQMLREWKAELHEP   69 (476)
Q Consensus        25 rvddLQ~~F~~LQ~ARKEsR~~D~avlEeQvhQmLREWkaEL~~p   69 (476)
                      .||||+++-..--.+|+|.-..==+++||++...++.|+..--+|
T Consensus       293 ~iDDL~~iv~~n~~~R~~~~~~ae~iIeee~~~~~~~l~~~~~~~  337 (414)
T COG0373         293 TIDDLEEIVEENLEARKEEAAKAEAIIEEELAEFMEWLKKLEVVP  337 (414)
T ss_pred             ehhhHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchH
Confidence            589999999888889999888888899999999998888766544


No 35 
>PF05385 Adeno_E4:  Mastadenovirus early E4 13 kDa protein;  InterPro: IPR008680 This family consists of Homo sapiens and simian mastadenovirus early E4 13 kDa proteins. Human adenovirus 9 (HAdV-9) is unique in eliciting exclusively estrogen-dependent mammary tumours in Rattus spp. and in not requiring viral E1 region transforming genes for tumorigenicity. E4 codes for an oncoprotein essential for tumourigenesis by Ad9 [].
Probab=20.61  E-value=35  Score=30.81  Aligned_cols=9  Identities=56%  Similarity=1.479  Sum_probs=7.7

Q ss_pred             hhhhhhccc
Q 011834          303 TIREWLFFD  311 (476)
Q Consensus       303 tiREWLFFD  311 (476)
                      .+||||||.
T Consensus        53 ~LrEWLy~a   61 (109)
T PF05385_consen   53 GLREWLYFA   61 (109)
T ss_pred             HHHHHHHHH
Confidence            489999994


No 36 
>PLN03166 60S ribosomal protein L34; Provisional
Probab=20.08  E-value=54  Score=28.67  Aligned_cols=16  Identities=38%  Similarity=0.752  Sum_probs=13.7

Q ss_pred             CCcccccCCCCCCCchhh
Q 011834          206 GPKCALWDCPRPAQGVDW  223 (476)
Q Consensus       206 gPKCALWDC~RPaqG~e~  223 (476)
                      +|||+  ||+.+.+|..-
T Consensus        41 ~pkC~--~cg~~L~Gi~~   56 (96)
T PLN03166         41 GPKCP--VTGKRIQGIPH   56 (96)
T ss_pred             CCcCC--CCCCccCCccC
Confidence            69998  99999999754


Done!