BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 011852
         (476 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2HJ1|A Chain A, Crystal Structure Of A 3d Domain-Swapped Dimer Of Protein
           Hi0395 From Haemophilus Influenzae
 pdb|2HJ1|B Chain B, Crystal Structure Of A 3d Domain-Swapped Dimer Of Protein
           Hi0395 From Haemophilus Influenzae
          Length = 97

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 287 AFPRKWFWVQCNVFEGATGEVALTAGGGLRQLPVLDSFENAAMIGI 332
           AFP +++     V EG T + A+T  G L Q P +D   N   IGI
Sbjct: 20  AFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNK--IGI 63


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.137    0.452 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,266,675
Number of Sequences: 62578
Number of extensions: 743571
Number of successful extensions: 1316
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1313
Number of HSP's gapped (non-prelim): 5
length of query: 476
length of database: 14,973,337
effective HSP length: 102
effective length of query: 374
effective length of database: 8,590,381
effective search space: 3212802494
effective search space used: 3212802494
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)