BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 011852
(476 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2HJ1|A Chain A, Crystal Structure Of A 3d Domain-Swapped Dimer Of Protein
Hi0395 From Haemophilus Influenzae
pdb|2HJ1|B Chain B, Crystal Structure Of A 3d Domain-Swapped Dimer Of Protein
Hi0395 From Haemophilus Influenzae
Length = 97
Score = 31.2 bits (69), Expect = 1.3, Method: Composition-based stats.
Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%)
Query: 287 AFPRKWFWVQCNVFEGATGEVALTAGGGLRQLPVLDSFENAAMIGI 332
AFP +++ V EG T + A+T G L Q P +D N IGI
Sbjct: 20 AFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNK--IGI 63
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.137 0.452
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,266,675
Number of Sequences: 62578
Number of extensions: 743571
Number of successful extensions: 1316
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1313
Number of HSP's gapped (non-prelim): 5
length of query: 476
length of database: 14,973,337
effective HSP length: 102
effective length of query: 374
effective length of database: 8,590,381
effective search space: 3212802494
effective search space used: 3212802494
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)